F-Droid Verification Server

F-Droid Verification Server

This is the Verification Server for https://f-droid.org. It rebuilds apps from source that were built by f-droid.org and checks that the results match. If they match, then there is a file named *.verified.txt added next to the APK that was verified. If not, then there is output from diffoscope in HTML and text.

The hardware resources to run this are provided by planck Security p≡p

[ICO]NameLast modifiedSizeDescription

[DIR]apache-logs/2019-11-05 21:31 -  
[DIR]binaries/2024-05-17 03:23 -  
[DIR]build-metadata/2018-01-25 15:55 -  
[DIR]check-fdroid-apk/2018-06-01 07:19 -  
[DIR]tmp/2013-07-10 06:56 -  
[DIR]unsigned/2024-05-29 06:50 -  
[   ]app.alextran.immich_69.apk.json2023-07-21 09:01 0  
[   ]app.mlauncher_40.apk.json2023-09-22 08:38 0  
[   ]bou.amine.apps.readerforselfossv2.android_122123571.apk.json2024-04-04 08:35 0  
[   ]br.com.colman.nato_100.apk.json2023-10-25 07:48 0  
[   ]ch.protonvpn.android_102064405.apk.json2023-09-14 06:28 0  
[   ]co.appreactor.news_22.apk.json2024-04-02 08:25 0  
[   ]com.akshayaap.mouseremote_5.apk.json2023-06-27 10:38 0  
[   ]com.alaskalinuxuser.justcraigslist_10.apk.json2023-06-10 11:16 0  
[   ]com.alovoa.alovoa_4.apk.json2024-04-03 08:24 0  
[   ]com.bald.uriah.baldphone_95.apk.json2023-05-27 09:19 0  
[   ]com.commit451.gitlab_2070400.apk.json2023-06-06 10:55 0  
[   ]com.darkempire78.opencalculator_42.apk.json2024-01-02 08:42 0  
[   ]com.dkanada.icecons_38.apk.json2023-06-10 10:50 0  
[   ]com.dosse.clock31_3.apk.json2024-01-02 08:41 0  
[   ]com.dozingcatsoftware.cardswithcats_1.apk.json2023-06-20 14:14 0  
[   ]com.fediphoto.lineage_64.apk.json2023-11-28 10:52 0  
[   ]com.forrestguice.suntimeswidget_102.apk.json2023-11-29 10:09 0  
[   ]com.forrestguice.suntimeswidget_105.apk.json2023-11-29 10:09 0  
[   ]com.github.bmx666.appcachecleaner_42.apk.json2023-10-24 07:42 0  
[   ]com.github.livingwithhippos.unchained_35.apk.json2023-07-11 18:12 0  
[   ]com.github.livingwithhippos.unchained_36.apk.json2023-09-13 07:43 0  
[   ]com.github.muellerma.mute_reminder_12.apk.json2023-12-08 10:08 0  
[   ]com.github.rsteube.t4_4.apk.json2023-12-07 09:42 0  
[   ]com.gmail.jiwopene.temperature_4.apk.json2023-09-11 19:00 0  
[   ]com.gpl.rpg.AndorsTrail_75.apk.json2024-01-17 10:59 0  
[   ]com.hanntech.free2pass_38.apk.json2023-11-29 09:46 0  
[   ]com.ismartcoding.plain_169.apk.json2024-03-30 13:44 0  
[   ]com.ismartcoding.plain_214.apk.json2024-03-23 15:22 0  
[   ]com.jefftharris.passwdsafe_6230300.apk.json2024-01-01 10:38 0  
[   ]com.jkuester.unlauncher_14.apk.json2023-11-29 09:38 0  
[   ]com.junjunguo.pocketmaps_39.apk.json2023-12-19 13:33 0  
[   ]com.katiearose.sobriety_18.apk.json2023-11-29 09:35 0  
[   ]com.martinmimigames.littlemusicplayer_11.apk.json2023-12-22 08:40 0  
[   ]com.mlkyh.hertz_6.apk.json2023-12-21 09:22 0  
[   ]com.mobile.bummerzaehler_160.apk.json2023-12-16 11:01 0  
[   ]com.netvor.settings.database.provider_1.apk.json2023-11-28 09:58 0  
[   ]com.nima.mymood_2.apk.json2023-09-18 12:43 0  
[   ]com.nononsenseapps.notepad_71000.apk.json2023-12-21 09:18 0  
[   ]com.nyxkn.meditation_7.apk.json2024-01-31 08:57 0  
[   ]com.openathena_29.apk.json2023-12-20 09:03 0  
[   ]com.openathena_31.apk.json2024-02-17 11:17 0  
[   ]com.orgzlyrevived_183.apk.json2024-01-18 08:14 0  
[   ]com.owncloud.android_40000000.apk.json2024-04-02 07:07 0  
[   ]com.palliser.nztides_18.apk.json2023-12-09 08:39 0  
[   ]com.palliser.nztides_19.apk.json2023-11-29 09:19 0  
[   ]com.pdb82.flashlighttiramisu_2.apk.json2024-02-01 08:34 0  
[   ]com.securefilemanager.app_12.apk.json2024-02-17 11:10 0  
[   ]com.series.aster.launcher_11.apk.json2024-01-10 08:33 0  
[   ]com.serwylo.babydots_10904.apk.json2024-01-10 08:31 0  
[   ]com.serwylo.babyphone_9.apk.json2023-12-08 09:23 0  
[   ]com.serwylo.babyphone_16.apk.json2024-01-03 07:53 0  
[   ]com.serwylo.babyphone_17.apk.json2024-02-08 08:16 0  
[   ]com.serwylo.lexica_30008.apk.json2024-02-08 08:16 0  
[   ]com.shifthackz.aisdv1.app.foss_161.apk.json2024-02-01 08:26 0  
[   ]com.simplemobiletools.gallery.pro_348.apk.json2024-01-02 07:45 0  
[   ]com.starry.myne_8.apk.json2023-09-20 12:58 0  
[   ]com.stoutner.privacycell_10.apk.json2023-12-22 08:19 0  
[   ]com.sweak.qralarm_8.apk.json2023-11-29 09:00 0  
[   ]com.sweak.qralarm_18.apk.json2023-12-19 12:56 0  
[   ]com.tananaev.logcat_14.apk.json2023-12-09 08:21 0  
[   ]com.termux.tasker_6.apk.json2023-11-29 08:58 0  
[   ]com.thatsmanmeet.taskyapp_26.apk.json2024-03-05 08:57 0  
[   ]com.therealbluepandabear.pixapencil_21.apk.json2024-03-26 13:18 0  
[   ]com.therealbluepandabear.pixapencil_26.apk.json2023-06-15 08:39 0  
[   ]com.torrents_csv_android_13.apk.json2024-03-26 13:17 0  
[   ]com.tserumula.dbcleanerforwhatsapp_6.apk.json2023-12-08 09:11 0  
[   ]com.tserumula.dbcleanerforwhatsapp_9.apk.json2024-04-02 06:44 0  
[   ]com.tutpro.baresip.plus_130.apk.json2024-02-07 08:38 0  
[   ]com.tutpro.baresip.plus_141.apk.json2023-11-29 08:51 0  
[   ]com.utazukin.ichaival_33.apk.json2024-02-14 08:57 0  
[   ]com.vincentengelsoftware.vesandroidimagecompare_31.apk.json2024-02-16 10:21 0  
[   ]com.vonglasow.michael.voltagedrop_10000.apk.json2023-12-19 12:41 0  
[   ]com.xtreak.notificationdictionary_18.apk.json2024-02-08 08:00 0  
[   ]com.yakovlevegor.DroidRec_3.apk.json2024-04-03 06:41 0  
[   ]com.zaneschepke.wireguardautotunnel_32200.apk.json2024-01-18 07:51 0  
[   ]com.zoffcc.applications.trifa_10197.apk.json2023-12-20 08:29 0  
[   ]com.zoffcc.applications.trifa_10202.apk.json2023-12-20 08:29 0  
[   ]cx.ring_393.apk.json2023-12-07 08:24 0  
[   ]de.blinkt.openvpn_175.apk.json2023-07-08 06:26 0  
[   ]de.blinkt.openvpn_197.apk.json2024-01-14 06:26 0  
[   ]de.danoeh.antennapod_2060295.apk.json2023-11-28 09:03 0  
[TXT]de.dennisguse.opentracks_5559.apk.diffoscope.txt2024-03-27 07:48 0  
[   ]de.drhoffmannsoft.pizza_12.apk.json2024-02-15 11:39 0  
[   ]de.freewarepoint.whohasmystuff_40.apk.json2023-12-09 07:58 0  
[   ]de.hauke_stieler.geonotes_1005002.apk.json2023-12-20 08:12 0  
[   ]de.jepfa.bdt_10101.apk.json2023-09-02 07:22 0  
[   ]de.jepfa.personaltasklogger_10600.apk.json2024-03-15 08:34 0  
[   ]de.jepfa.yapm_106002.apk.json2023-07-12 07:51 0  
[   ]de.k3b.android.camerafolder_4.apk.json2024-03-15 08:34 0  
[   ]de.kromke.andreas.cameradatefolders_4.apk.json2023-07-27 07:50 0  
[   ]de.kromke.andreas.musictagger_25.apk.json2024-03-14 11:48 0  
[   ]de.kromke.andreas.opus1musicplayer_72.apk.json2024-02-01 07:56 0  
[   ]de.markusfisch.android.pielauncher_21.apk.json2024-03-08 08:37 0  
[   ]de.marmaro.krt.ffupdater_131.apk.json2023-07-22 07:49 0  
[   ]de.meonwax.soundboard_4.apk.json2023-07-18 07:57 0  
[   ]de.moekadu.tuner_31.apk.json2024-03-14 11:45 0  
[   ]de.msal.muzei.nationalgeographic_20403.apk.json2024-02-08 07:30 0  
[   ]de.msal.muzei.nationalgeographic_20404.apk.json2023-12-22 07:40 0  
[   ]de.niendo.ImapNotes3_10012.apk.json2024-02-17 08:52 0  
[   ]de.niendo.ImapNotes3_10014.apk.json2024-02-15 11:31 0  
[   ]de.niendo.ImapNotes3_10301.apk.json2024-02-16 10:00 0  
[   ]de.niendo.ImapNotes3_10305.apk.json2024-03-27 07:39 0  
[   ]de.nulide.findmydevice_17.apk.json2024-02-01 07:50 0  
[   ]de.rwth_aachen.phyphox_1011002.apk.json2024-03-15 08:26 0  
[   ]de.salomax.currencies_12002.apk.json2024-01-31 08:08 0  
[   ]de.sorunome.unifiednlp.trains_14.apk.json2023-10-23 08:22 0  
[   ]de.szalkowski.activitylauncher.rustore_fork_137.apk.json2024-03-08 08:28 0  
[   ]de.thefeiter.liedgutverzeichnis_64.apk.json2024-02-01 07:48 0  
[   ]de.thefeiter.liedgutverzeichnis_71.apk.json2023-12-21 08:20 0  
[   ]de.thefeiter.liedgutverzeichnis_72.apk.json2024-03-06 08:55 0  
[   ]design.codeux.authpass.fdroid_162.apk.json2024-01-02 07:12 0  
[   ]design.codeux.authpass.fdroid_164.apk.json2024-03-06 08:59 0  
[   ]dev.corruptedark.openchaoschess_53.apk.json2023-12-07 08:01 0  
[   ]dev.datlag.burningseries_440.apk.json2023-10-23 08:22 0  
[   ]dev.leonlatsch.photok_23.apk.json2023-12-22 07:34 0  
[   ]dnsfilter.android_1505305.apk.json2024-01-17 07:54 0  
[   ]dubrowgn.wattz_12.apk.json2023-11-29 08:17 0  
[   ]es.eoinrul.ecwt_46.apk.json2024-02-08 07:23 0  
[   ]eu.darken.capod_21000020.apk.json2023-12-09 07:38 0  
[   ]eu.roggstar.luigithehunter.batterycalibrate_13.apk.json2024-01-10 07:36 0  
[   ]eu.roggstar.luigithehunter.dsaassistent_60.apk.json2024-01-25 07:54 0  
[   ]eu.schmidt.systems.opensyncedlists_9.apk.json2023-12-30 10:00 0  
[   ]eu.siacs.conversations_199.apk.json2023-09-28 06:26 0  
[   ]exe.bbllw8.anemo_15.apk.json2024-03-06 08:46 0  
[   ]foehnix.widget_38.apk.json2024-01-25 07:54 0  
[   ]fr.bellev.stdatmosphere_2.apk.json2023-11-28 08:38 0  
[   ]fr.corenting.traficparis_29.apk.json2023-11-29 08:10 0  
[   ]fr.fdesousa.bikesharinghub_25.apk.json2023-12-07 07:48 0  
[   ]fr.free.nrw.commons_1036.apk.json2024-03-15 08:10 0  
[   ]fr.gouv.etalab.mastodon_484.apk.json2024-02-01 07:42 0  
[   ]fr.nuage.souvenirs_28.apk.json2024-03-27 07:17 0  
[   ]free.rm.skytube.oss_41.apk.json2024-02-16 09:47 0  
[   ]helium314.localbackend_29.apk.json2023-09-15 08:03 0  
[   ]helium314.localbackend_39.apk.json2024-02-22 11:16 0  
[   ]horse.amazin.my.stratum0.statuswidget_28.apk.json2023-11-28 08:19 0  
[   ]hu.vmiklos.plees_tracker_40.apk.json2024-03-26 08:18 0  
[   ]hu.vmiklos.plees_tracker_43.apk.json2024-03-07 08:17 0  
[   ]in.sunilpaulmathew.ashell_6.apk.json2024-02-27 08:20 0  
[   ]inc.flide.vi8_12.apk.json2023-12-16 08:48 0  
[   ]info.metadude.android.clt.schedule_87.apk.json2023-12-07 07:41 0  
[   ]info.metadude.android.divoc.schedule_88.apk.json2024-02-26 20:31 0  
[   ]info.metadude.android.fosdem.schedule_86.apk.json2023-12-30 09:53 0  
[   ]info.metadude.android.hope.schedule_89.apk.json2023-07-21 07:25 0  
[   ]info.plateaukao.einkbro_101400.apk.json2024-02-07 07:32 0  
[   ]info.plateaukao.einkbro_110000.apk.json2024-03-22 08:50 0  
[   ]info.plateaukao.einkbro_110301.apk.json2024-03-06 08:35 0  
[   ]io.github.chiver_211.apk.json2024-02-08 07:08 0  
[   ]io.github.divverent.aaaaxy_103030103.apk.json2023-12-07 07:37 0  
[   ]io.github.project_kaat.gpsdrelay_1.apk.json2023-10-23 08:16 0  
[   ]io.github.project_kaat.gpsdrelay_2.apk.json2024-03-07 08:07 0  
[   ]io.github.yawnoc.strokeinput_55.apk.json2024-03-23 15:13 0  
[   ]io.github.zyrouge.symphony_73.apk.json2023-06-02 01:13 0  
[   ]io.heckel.ntfy_27.apk.json2024-03-07 08:04 0  
[   ]io.horizontalsystems.bankwallet_76.apk.json2023-12-22 07:09 0  
[   ]it.niedermann.nextcloud.deck_1021008.apk.json2024-01-13 08:05 0  
[   ]it.niedermann.nextcloud.deck_1023004.apk.json2024-04-14 03:12 0  
[   ]it.niedermann.owncloud.notes_40000090.apk.json2024-02-07 07:14 0  
[   ]it.niedermann.owncloud.notes_40010051.apk.json2024-02-26 20:10 0  
[   ]juloo.keyboard2_26.apk.json2024-02-16 08:47 0  
[   ]juloo.keyboard2_29.apk.json2024-03-16 07:24 0  
[   ]juloo.keyboard2_37.apk.json2024-02-29 00:17 0  
[   ]la.daube.photochiotte_35.apk.json2024-03-08 07:55 0  
[   ]liou.rayyuan.ebooksearchtaiwan_1922210103.apk.json2024-02-29 08:07 0  
[   ]luke.launcher_20004.apk.json2023-12-26 07:40 0  
[   ]me.timeto.app_462.apk.json2024-04-18 08:16 0  
[   ]mobi.maptrek_84.apk.json2024-02-14 07:36 0  
[   ]mobi.maptrek_88.apk.json2023-12-30 09:25 0  
[   ]moe.dic1911.autodnd_3.apk.json2024-02-29 07:52 0  
[   ]moe.dic1911.urlsanitizer_24.apk.json2024-02-19 07:51 0  
[   ]moe.matsuri.lite_909.apk.json2024-01-17 06:48 0  
[   ]net.basov.omn.fdroid_3002.apk.json2024-01-03 06:35 0  
[   ]net.basov.omn.fdroid_3200.apk.json2023-12-30 09:24 0  
[   ]net.cozic.joplin_2097736.apk.json2024-02-23 07:48 0  
[   ]net.gsantner.markor_145.apk.json2024-05-09 07:37 0  
[   ]net.ivpn.client_118.apk.json2024-05-11 06:26 0  
[   ]net.kourlas.voipms_sms_144.apk.json2024-02-08 06:44 0  
[   ]net.kourlas.voipms_sms_146.apk.json2024-02-26 19:52 0  
[   ]net.minetest.minetest_46.apk.json2024-02-08 06:42 0  
[   ]net.moasdawiki.app_40.apk.json2024-04-16 07:59 0  
[   ]net.moasdawiki.app_42.apk.json2024-03-07 07:37 0  
[   ]net.mullvad.mullvadvpn_22010099.apk.json2023-09-26 07:02 0  
[   ]net.sourceforge.dibdib.android.dib2qm_2276.apk.json2024-04-20 07:43 0  
[   ]net.sourceforge.solitaire_cg_705.apk.json2023-06-01 23:13 0  
[   ]net.stargw.applist_17.apk.json2024-02-17 07:55 0  
[   ]net.stargw.fok_61.apk.json2024-04-19 07:52 0  
[   ]net.taler.wallet.fdroid_32.apk.json2024-03-07 07:33 0  
[   ]net.tevp.postcode_5.apk.json2023-06-08 08:55 0  
[   ]net.tjado.passwdsafe_401.apk.json2024-03-09 20:37 0  
[   ]network.mysterium.vpn_107162.apk.json2023-06-23 06:25 0  
[   ]network.mysterium.vpn_107166.apk.json2023-09-21 07:05 0  
[   ]network.mysterium.vpn_107170.apk.json2024-01-10 06:39 0  
[   ]network.mysterium.vpn_107175.apk.json2024-01-25 07:13 0  
[   ]nl.tsmeets.todotree_4.apk.json2023-12-22 06:38 0  
[   ]om.sstvencoder_28.apk.json2024-02-27 07:39 0  
[   ]org.alberto97.aodtoggle_2.apk.json2024-02-17 07:49 0  
[   ]org.asafonov.monly_41.apk.json2024-02-27 07:38 0  
[   ]org.avmedia.gshockGoogleSync_40.apk.json2023-09-22 07:59 0  
[   ]org.avmedia.gshockGoogleSync_61.apk.json2023-09-28 06:51 0  
[   ]org.avmedia.gshockGoogleSync_94.apk.json2023-12-08 06:45 0  
[   ]org.avmedia.gshockGoogleSync_95.apk.json2024-01-25 07:10 0  
[   ]org.bc_bd.mrwhite_6.apk.json2023-07-05 08:33 0  
[   ]org.billthefarmer.currency_130.apk.json2023-06-28 07:05 0  
[   ]org.billthefarmer.currency_145.apk.json2023-06-29 07:07 0  
[   ]org.billthefarmer.currency_148.apk.json2024-02-07 06:40 0  
[   ]org.billthefarmer.editor_174.apk.json2024-01-31 06:54 0  
[   ]org.billthefarmer.editor_185.apk.json2024-02-14 07:18 0  
[   ]org.billthefarmer.gridle_110.apk.json2024-02-16 08:12 0  
[   ]org.billthefarmer.gurgle_125.apk.json2023-12-08 06:43 0  
[   ]org.billthefarmer.gurgle_126.apk.json2023-12-10 06:44 0  
[   ]org.billthefarmer.notes_133.apk.json2023-11-28 07:21 0  
[   ]org.billthefarmer.notes_134.apk.json2023-12-08 06:44 0  
[   ]org.billthefarmer.notes_135.apk.json2024-02-07 06:37 0  
[   ]org.billthefarmer.scope_135.apk.json2024-02-19 07:32 0  
[   ]org.billthefarmer.siggen_130.apk.json2024-02-22 10:27 0  
[   ]org.billthefarmer.specie_107.apk.json2024-03-06 07:33 0  
[   ]org.billthefarmer.tuner_146.apk.json2024-04-18 07:48 0  
[   ]org.bitbatzen.wlanscanner_7.apk.json2023-12-17 06:38 0  
[   ]org.codeberg.genericpers0n.soundrecorderplus_100.apk.json2024-04-12 07:34 0  
[   ]org.fcitx.fcitx5.android.plugin.chewing_64.apk.json2024-04-08 07:27 0  
[   ]org.fcitx.fcitx5.android.plugin.jyutping_64.apk.json2024-04-18 07:38 0  
[   ]org.fdroid.fdroid_1000011.apk.json2023-09-14 06:28 0  
[   ]org.github.henryquan.animeone_118.apk.json2024-01-31 06:46 0  
[   ]org.gnu.icecat_520310.apk.json2023-11-19 06:39 0  
[   ]org.gnu.icecat_600310.apk.json2023-09-24 06:47 0  
[   ]org.godotengine.editor.v3_306002003.apk.json2023-10-01 06:46 0  
[   ]org.greatfire.wikiunblocked.fdroid_1003804.apk.json2023-10-24 06:41 0  
[   ]org.herrlado.ask.languagepack.czech_2234.apk.json2023-05-25 08:41 0  
[   ]org.ietf.ietfsched_55.apk.json2024-02-14 07:07 0  
[   ]org.joinmastodon.android_64.apk.json2024-05-11 07:17 0  
[   ]org.krita_5011704.apk.json2024-04-19 07:16 0  
[   ]org.libreoffice.impressremote_30.apk.json2024-02-01 06:35 0  
[   ]org.mian.gitnex_521.apk.json2024-05-11 07:10 0  
[   ]org.microg.nlp.backend.ichnaea_20036.apk.json2024-02-17 07:03 0  
[   ]org.mosad.teapod_100992.apk.json2024-02-19 07:11 0  
[   ]org.mozilla.fennec_fdroid_510410.apk.json2023-09-26 07:36 0  
[   ]org.mozilla.fennec_fdroid_683020.apk.json2023-06-24 09:39 0  
[   ]org.mozilla.fennec_fdroid_689020.apk.json2023-10-22 06:39 0  
[   ]org.noise_planet.noisecapture_59.apk.json2023-11-28 06:59 0  
[   ]org.openhab.habdroid.beta_505.apk.json2024-05-09 06:50 0  
[   ]org.openhab.habdroid.beta_508.apk.json2024-04-08 07:04 0  
[   ]org.openhab.habdroid.beta_513.apk.json2024-05-09 06:50 0  
[   ]org.openhab.habdroid.beta_521.apk.json2024-03-29 07:05 0  
[   ]org.openobservatory.ooniprobe_91.apk.json2024-02-27 07:03 0  
[   ]org.openobservatory.ooniprobe_94.apk.json2024-04-16 07:06 0  
[   ]org.osmdroid_49.apk.json2024-02-17 06:57 0  
[   ]org.pacien.tincapp_28.apk.json2023-11-06 07:07 0  
[   ]org.pacien.tincapp_33.apk.json2023-09-12 06:30 0  
[   ]org.pacien.tincapp_38.apk.json2024-03-07 06:25 0  
[   ]org.pixeldroid.app_21.apk.json2024-05-09 06:45 0  
[   ]org.privacymatters.safespace_19.apk.json2024-05-09 06:43 0  
[   ]org.projectmaxs.module.wifiaccess_2000504755.apk.json2024-03-07 06:51 0  
[   ]org.proninyaroslav.libretorrent_11.apk.json2023-05-28 06:47 0  
[   ]org.purplei2p.i2pd_2500200.apk.json2024-05-13 06:53 0  
[   ]org.quantumbadger.redreader_108.apk.json2024-01-25 06:46 0  
[   ]org.quantumbadger.redreader_110.apk.json2024-04-08 06:56 0  
[   ]org.schabi.newpipe_69.apk.json2023-10-26 06:26 0  
[   ]org.scoutant.rpn_4.apk.json2024-04-08 06:53 0  
[   ]org.secuso.privacyfriendlyludo_6.apk.json2024-01-28 06:46 0  
[   ]org.talkingpanda.osram_remote_11.apk.json2024-03-26 07:15 0  
[   ]org.torproject.torservices_2014.apk.json2024-02-22 09:43 0  
[   ]org.totschnig.myexpenses_709.apk.json2024-04-20 06:50 0  
[   ]org.transdroid.search_38.apk.json2024-04-12 06:49 0  
[   ]org.woheller69.audiometry_140.apk.json2024-01-25 06:38 0  
[   ]org.woheller69.omweather_15.apk.json2023-12-08 06:30 0  
[   ]org.woheller69.solxpect_13.apk.json2023-09-29 06:33 0  
[   ]org.woheller69.weather_59.apk.json2024-02-29 06:44 0  
[   ]org.woheller69.whobird_22.apk.json2024-04-21 06:43 0  
[   ]pl.edu.pjwstk.s999844.shoppinglist_15.apk.json2024-04-06 06:42 0  
[   ]rasel.lunar.launcher_26.apk.json2023-09-27 06:37 0  
[   ]ro.hume.cosmin.retrostack_4.apk.json2024-02-22 09:31 0  
[   ]starcom.snd_5.apk.json2024-04-10 06:33 0  
[   ]uk.co.yahoo.p1rpp.secondsclock_7.apk.json2024-02-23 06:30 0  
[   ]uk.openvk.android.legacy_157.apk.json2023-06-10 06:28 0  
[   ]uk.openvk.android.legacy_182.apk.json2024-03-06 06:29 0  
[   ]uk.openvk.android.legacy_214.apk.json2024-03-07 06:27 0  
[   ]verified.json2024-05-17 07:02 0  
[   ]xyz.deepdaikon.xeonjia_13.apk.json2023-11-01 06:29 0  
[   ]xyz.myachin.downloader_9.apk.json2024-01-03 06:26 0  
[   ]xyz.myachin.saveto_23.apk.json2023-11-29 06:27 0  
[   ]zame.GloomyDungeons.opensource.game_1414314000.apk.json2023-10-27 06:25 0  
[   ]test-jar2017-01-03 18:17 25  
[TXT]a2dp.Vol_135.apk.verified.txt2017-05-07 15:03 36  
[TXT]anupam.acrylic_15.apk.verified.txt2017-05-07 14:46 36  
[TXT]app.varlorg.unote.verified.txt2017-01-13 10:47 36  
[TXT]app.varlorg.unote_7.apk.verified.txt2017-05-07 14:46 36  
[TXT]at.linuxtage.companion_700138.apk.verified.txt2017-05-07 14:41 36  
[TXT]at.linuxtage.companion_700144.apk.verified.txt2017-05-07 14:41 36  
[TXT]au.com.wallaceit.reddinator_62.apk.verified.txt2017-05-07 14:27 36  
[TXT]be.ppareit.swiftp_free_21301.apk.verified.txt2017-05-07 14:18 36  
[TXT]br.com.frs.foodrestrictions_2.apk.verified.txt2017-05-07 14:11 36  
[TXT]ca.cmetcalfe.locationshare_3.apk.verified.txt2017-05-07 13:58 36  
[TXT]ca.cmetcalfe.xposed.flatconnectivityicons_1.apk.verified.txt2017-05-07 13:58 36  
[TXT]ca.farrelltonsolar.classic.verified.txt2017-01-13 09:52 36  
[TXT]ca.farrelltonsolar.classic_245.apk.verified.txt2017-05-07 13:51 36  
[TXT]ca.farrelltonsolar.classic_250.apk.verified.txt2017-05-07 13:51 36  
[TXT]ca.rmen.android.poetassistant_11800.apk.verified.txt2017-05-07 13:50 36  
[TXT]ca.rmen.android.scrumchatter_10602.apk.verified.txt2017-05-07 13:50 36  
[TXT]ca.rmen.nounours_345.apk.verified.txt2017-05-07 13:49 36  
[TXT]ch.bailu.aat_16.apk.verified.txt2017-05-07 13:33 36  
[TXT]ch.bailu.aat_17.apk.verified.txt2017-05-07 13:33 36  
[TXT]ch.blinkenlights.android.vanilla_10460.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10470.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10480.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10490.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10500.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10510.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.hgdev.toposuite_69.apk.verified.txt2017-05-07 13:28 36  
[TXT]ch.logixisland.anuto_9.apk.verified.txt2017-05-07 13:23 36  
[TXT]click.dummer.textthing_191.apk.verified.txt2017-05-07 13:17 36  
[TXT]click.dummer.textthing_192.apk.verified.txt2017-05-07 13:17 36  
[TXT]com.MarcosDiez.shareviahttp_25.apk.verified.txt2017-05-07 13:13 36  
[TXT]com.adam.aslfms_44.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.adonai.manman_162.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.agateau.catgenerator_2.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.anddevw.getchromium_20170318.apk.verified.txt2017-05-07 12:41 36  
[TXT]com.android.music_2.apk.verified.txt2017-05-07 09:30 36  
[TXT]com.anysoftkeyboard.languagepack.basque_1.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.german_103.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.greek_200.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.hebrew_102.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.italian_100.apk.verified.txt2017-05-07 09:12 36  
[TXT]com.anysoftkeyboard.languagepack.latvian_100.apk.verified.txt2017-05-07 09:12 36  
[TXT]com.anysoftkeyboard.languagepack.neo_7.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.neo_8.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.norwegian_101.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.russian2_101.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.slovene_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.spain_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.swedish_103.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.tatar_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.ukrainian_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.app.Zensuren_121.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.arnaud.metronome_2.apk.verified.txt2017-05-07 09:07 36  
[TXT]com.byagowi.persiancalendar_522.apk.verified.txt2017-05-06 12:50 36  
[TXT]com.cgogolin.library_24.apk.verified.txt2017-05-06 12:47 36  
[TXT]com.cgogolin.library_27.apk.verified.txt2017-05-06 12:47 36  
[TXT]com.cityfreqs.littlesirecho_4.apk.verified.txt2017-05-06 10:11 36  
[TXT]com.commit451.gitlab_2040300.apk.verified.txt2017-05-06 10:02 36  
[TXT]com.coste.syncorg_10.apk.verified.txt2017-05-06 09:57 36  
[TXT]com.darshancomputing.BatteryIndicator.verified.txt2017-01-13 02:13 36  
[TXT]com.darshancomputing.BatteryIndicator_13018.apk.verified.txt2017-05-06 09:06 36  
[TXT]com.darshancomputing.BatteryIndicator_13022.apk.verified.txt2017-05-06 09:06 36  
[TXT]com.dftec.planetcon_13.apk.verified.txt2017-05-06 08:33 36  
[TXT]com.easwareapps.transparentwidget.verified.txt2017-01-13 01:12 36  
[TXT]com.easwareapps.transparentwidget_2.apk.verified.txt2017-05-06 07:41 36  
[TXT]com.ebaschiera.triplecamel_8.apk.verified.txt2017-05-06 07:40 36  
[TXT]com.eneko.hexcolortimewallpaper_2.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.earthquake.batterysimplysolid_12.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.earthquake_13.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.filemanager_5.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.sample_3.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.fr3ts0n.stagefever_10009.apk.verified.txt2017-05-06 06:58 36  
[TXT]com.fsck.k9.material_24001.apk.verified.txt2017-05-06 06:55 36  
[TXT]com.futurice.android.reservator_17.apk.verified.txt2017-05-06 06:54 36  
[TXT]com.gcstar.viewer_14.apk.verified.txt2017-05-06 06:47 36  
[TXT]com.ghostsq.commander_317.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_318.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_322.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_323.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghstudios.android.mhgendatabase_6.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.github.sryze.wirebug.verified.txt2017-01-12 23:31 36  
[TXT]com.github.sryze.wirebug_101.apk.verified.txt2017-05-06 06:02 36  
[TXT]com.github.yeriomin.dumbphoneassistant_5.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.github.yeriomin.smsscheduler.verified.txt2017-01-12 23:30 36  
[TXT]com.github.yeriomin.smsscheduler_4.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.github.yeriomin.yalpstore_9.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.greenaddress.abcore_54.apk.verified.txt2017-05-06 04:08 36  
[TXT]com.gunshippenguin.openflood_12.apk.verified.txt2017-05-06 04:06 36  
[TXT]com.haringeymobile.ukweather_27.apk.verified.txt2017-05-06 03:49 36  
[TXT]com.hayaisoftware.launcher.verified.txt2017-01-12 21:35 36  
[TXT]com.hayaisoftware.launcher_10404.apk.verified.txt2017-05-06 03:47 36  
[TXT]com.hayaisoftware.launcher_10405.apk.verified.txt2017-05-06 03:47 36  
[TXT]com.iazasoft.footguy_6.apk.verified.txt2017-05-06 03:38 36  
[TXT]com.ichi2.anki_20802300.apk.verified.txt2017-05-06 03:37 36  
[TXT]com.infonuascape.osrshelper_14.apk.verified.txt2017-05-06 03:35 36  
[TXT]com.iven.lfflfeedreader_63.apk.verified.txt2017-05-06 02:58 36  
[TXT]com.jarsilio.android.waveup_25.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jarsilio.android.waveup_26.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jarsilio.android.waveup_27.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jmstudios.redmoon_27.apk.verified.txt2017-05-06 02:45 36  
[TXT]com.jmstudios.redmoon_28.apk.verified.txt2017-05-06 02:45 36  
[TXT]com.kanedias.vanilla.coverfetch_3.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.kanedias.vanilla.lyrics_5.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.keylesspalace.tusky_5.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.knirirr.beecount_117.apk.verified.txt2017-05-06 02:35 36  
[TXT]com.launcher.silverfish.verified.txt2017-01-12 20:24 36  
[TXT]com.launcher.silverfish_2.apk.verified.txt2017-05-06 02:30 36  
[TXT]com.llamacorp.equate_4.apk.verified.txt2017-05-06 01:21 36  
[TXT]com.llamacorp.equate_5.apk.verified.txt2017-05-06 01:21 36  
[TXT]com.mantz_it.rfanalyzer_1303.apk.verified.txt2017-05-06 00:57 36  
[TXT]com.mareksebera.simpledilbert.verified.txt2017-01-12 18:51 36  
[TXT]com.mareksebera.simpledilbert_36.apk.verified.txt2017-05-06 00:56 36  
[TXT]com.mareksebera.simpledilbert_37.apk.verified.txt2017-05-06 00:56 36  
[TXT]com.mikifus.padland_12.apk.verified.txt2017-05-06 00:08 36  
[TXT]com.miqote.shanawp_10.apk.verified.txt2017-05-06 00:06 36  
[TXT]com.mobilepearls.sokoban_14.apk.verified.txt2017-05-06 00:03 36  
[TXT]com.movim.movim_8.apk.verified.txt2017-05-05 22:40 36  
[TXT]com.mschlauch.comfortreader_6.apk.verified.txt2017-05-05 22:38 36  
[TXT]com.nltechno.dolidroidpro_28.apk.verified.txt2017-05-05 21:24 36  
[TXT]com.notecryptpro_18.apk.verified.txt2017-05-05 21:10 36  
[TXT]com.oakley.fon_152.apk.verified.txt2017-05-05 20:49 36  
[TXT]com.orgzly_58.apk.verified.txt2017-05-05 20:46 36  
[TXT]com.orpheusdroid.screenrecorder_13.apk.verified.txt2017-05-05 20:32 36  
[TXT]com.palliser.nztides_11.apk.verified.txt2017-05-05 20:30 36  
[TXT]com.philliphsu.clock2_113.apk.verified.txt2017-05-05 20:25 36  
[TXT]com.phpsysinfo_910.apk.verified.txt2017-05-05 20:24 36  
[TXT]com.prhlt.aemus.Read4SpeechExperiments_18.apk.verified.txt2017-05-05 19:51 36  
[TXT]com.quaap.launchtime_4.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.launchtime_51.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.launchtime_52.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.primary_3.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.rastating.droidbeard_1502.apk.verified.txt2017-05-05 18:10 36  
[TXT]com.redirectapps.tvkill_20.apk.verified.txt2017-05-05 18:09 36  
[TXT]com.rubenwardy.minetestmodmanager_14.apk.verified.txt2017-05-05 18:03 36  
[TXT]com.samebits.beacon.locator_111.apk.verified.txt2017-05-05 17:17 36  
[TXT]com.seafile.seadroid2_65.apk.verified.txt2017-05-05 17:00 36  
[TXT]com.secuso.privacyFriendlyCodeScanner_9.apk.verified.txt2017-05-05 16:08 36  
[TXT]com.simplemobiletools.camera_32.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.flashlight_21.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.musicplayer_27.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.notes_28.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.stoutner.privacybrowser.standard_18.apk.verified.txt2017-05-05 13:07 36  
[TXT]com.termux.api_13.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.styling_16.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.tasker_1.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.widget_7.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.ultramegatech.ey_28.apk.verified.txt2017-05-05 09:40 36  
[TXT]com.vrem.wifianalyzer_26.apk.verified.txt2017-05-05 08:45 36  
[TXT]com.wbrenna.gtfsoffline_10.apk.verified.txt2017-05-05 08:14 36  
[TXT]com.wmstein.transektcount_200.apk.verified.txt2017-05-05 08:02 36  
[TXT]com.wolas.awesomewallpaper.verified.txt2017-01-12 06:55 36  
[TXT]com.wolas.awesomewallpaper_1.apk.verified.txt2017-05-05 08:02 36  
[TXT]com.workingagenda.democracydroid_26.apk.verified.txt2017-05-05 08:01 36  
[TXT]com.workingagenda.democracydroid_28.apk.verified.txt2017-05-05 08:01 36  
[TXT]com.xargsgrep.portknocker_12.apk.verified.txt2017-05-05 07:58 36  
[TXT]com.yubico.yubioath_29.apk.verified.txt2017-05-05 07:38 36  
[TXT]cz.martykan.forecastie.verified.txt2017-01-12 05:09 36  
[TXT]cz.martykan.forecastie_13.apk.verified.txt2017-05-05 05:38 36  
[TXT]damo.three.ie_19.apk.verified.txt2017-05-05 05:37 36  
[TXT]de.arnowelzel.android.periodical_30.apk.verified.txt2017-05-05 05:27 36  
[TXT]de.audioattack.openlink_12.apk.verified.txt2017-05-05 05:27 36  
[TXT]de.baumann.browser_21.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.hhsmoodle_48.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.pdfcreator_12.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.pdfcreator_14.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.quitsmoking_11.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.thema_39.apk.verified.txt2017-05-05 05:23 36  
[TXT]de.baumann.thema_40.apk.verified.txt2017-05-05 05:23 36  
[TXT]de.baumann.weather_34.apk.verified.txt2017-05-05 05:21 36  
[TXT]de.baumann.weather_36.apk.verified.txt2017-05-05 05:21 36  
[TXT]de.chaosdorf.meteroid.verified.txt2017-01-12 05:03 36  
[TXT]de.chaosdorf.meteroid_22.apk.verified.txt2017-05-05 05:17 36  
[TXT]de.cryptobitch.muelli.barcodegen_2.apk.verified.txt2017-05-05 05:16 36  
[TXT]de.dotwee.micropinner.verified.txt2017-01-12 04:48 36  
[TXT]de.dotwee.micropinner_24.apk.verified.txt2017-05-05 05:11 36  
[TXT]de.freewarepoint.whohasmystuff.verified.txt2017-01-12 04:45 36  
[TXT]de.freewarepoint.whohasmystuff_26.apk.verified.txt2017-05-05 03:49 36  
[TXT]de.grobox.blitzmail_12.apk.verified.txt2017-05-05 03:47 36  
[TXT]de.grobox.liberario_47.apk.verified.txt2017-05-05 03:47 36  
[TXT]de.hirtenstrasse.michael.lnkshortener_5.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.hoffmannsgimmickstaupunkt_16.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.j4velin.systemappmover_172.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.jkliemann.parkendd_26.apk.verified.txt2017-05-05 03:41 36  
[TXT]de.k3b.android.androFotoFinder_24.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.k3b.android.androFotoFinder_26.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.k3b.android.androFotoFinder_28.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.koelle.christian.trickytripper_21.apk.verified.txt2017-05-05 03:18 36  
[TXT]de.kromke.andreas.unpopmusicplayerfree_7.apk.verified.txt2017-05-05 03:18 36  
[TXT]de.mangelow.balance_3.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.debdroid_4.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.debdroid_5.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.slideitloud_7.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.mangelow.syncwifi_17.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.mangelow.throughput_15.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.markusfisch.android.shadereditor_29.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.msal.muzei.nationalgeographic_9.apk.verified.txt2017-05-05 02:49 36  
[TXT]de.onyxbits.listmyapps.verified.txt2017-01-12 03:45 36  
[TXT]de.onyxbits.listmyapps_17.apk.verified.txt2017-05-05 02:10 36  
[TXT]de.quaddyservices.dynamicnightlight_2041.apk.verified.txt2017-05-05 01:35 36  
[TXT]de.reimardoeffinger.quickdic_82.apk.verified.txt2017-05-05 01:34 36  
[TXT]de.schildbach.wallet_298.apk.verified.txt2017-05-05 01:31 36  
[TXT]de.vibora.viborafeed_27.apk.verified.txt2017-05-05 01:04 36  
[TXT]de.xskat_14.apk.verified.txt2017-05-05 00:57 36  
[TXT]dk.jens.backup_19.apk.verified.txt2017-05-05 00:51 36  
[TXT]es.esy.CosyDVR_21.apk.verified.txt2017-05-05 00:12 36  
[TXT]es.esy.CosyDVR_22.apk.verified.txt2017-05-05 00:12 36  
[TXT]eu.flatworld.android.slider.verified.txt2017-01-12 01:54 36  
[TXT]eu.flatworld.android.slider_20301.apk.verified.txt2017-05-05 00:00 36  
[TXT]eu.polarclock_5.apk.verified.txt2017-05-04 22:08 36  
[TXT]eu.siacs.conversations_199.apk.verified.txt2017-05-04 22:00 36  
[TXT]eu.veldsoft.complica4.verified.txt2017-01-12 00:40 36  
[TXT]eu.veldsoft.complica4_4.apk.verified.txt2017-05-04 21:53 36  
[TXT]eu.veldsoft.ithaka.board.game.verified.txt2017-01-12 00:01 36  
[TXT]eu.veldsoft.ithaka.board.game_5.apk.verified.txt2017-05-04 21:14 36  
[TXT]eu.wikijourney.wikijourney_21.apk.verified.txt2017-05-11 09:51 36  
[TXT]felixwiemuth.lincal_9.apk.verified.txt2017-05-11 09:51 36  
[TXT]fly.speedmeter.grub_24.apk.verified.txt2017-05-11 09:48 36  
[TXT]fr.free.nrw.commons_60.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.gaulupeau.apps.InThePoche_31.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.gaulupeau.apps.InThePoche_32.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.herverenault.selfhostedgpstracker_13.apk.verified.txt2017-05-11 07:34 36  
[TXT]fr.kwiatkowski.ApkTrack_19.apk.verified.txt2017-05-11 07:29 36  
[TXT]fr.mobdev.goblim_7.apk.verified.txt2017-05-11 07:24 36  
[TXT]fr.neamar.kiss_92.apk.verified.txt2017-05-11 07:24 36  
[TXT]fr.unix_experience.owncloud_sms_45.apk.verified.txt2017-05-11 07:08 36  
[TXT]fr.xtof54.mousetodon_1.apk.verified.txt2017-05-11 07:07 36  
[TXT]free.rm.skytube.oss_5.apk.verified.txt2017-05-11 07:05 36  
[TXT]grmpl.mk.stepandheightcounter_5.apk.verified.txt2017-05-11 05:58 36  
[TXT]in.shick.diode_18.apk.verified.txt2017-05-11 05:36 36  
[TXT]in.shick.diode_19.apk.verified.txt2017-05-11 05:36 36  
[TXT]info.guardianproject.checkey.verified.txt2017-01-11 19:47 36  
[TXT]info.guardianproject.checkey_101.apk.verified.txt2017-05-11 05:12 36  
[TXT]info.meoblast001.thugaim_1.apk.verified.txt2017-05-11 03:40 36  
[TXT]info.meoblast001.thugaim_2.apk.verified.txt2017-05-11 03:40 36  
[TXT]io.github.engsergiu.react_4.apk.verified.txt2017-05-11 02:46 36  
[TXT]io.github.fvasco.pinpoi_39.apk.verified.txt2017-05-11 02:46 36  
[TXT]io.github.lonamiwebs.klooni_400.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.lonamiwebs.klooni_500.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.lonamiwebs.stringlate_990.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.tjg1.nori_9.apk.verified.txt2017-05-11 02:41 36  
[TXT]it.feio.android.omninotes.foss_230.apk.verified.txt2017-05-10 23:11 36  
[TXT]it.langolonerd.app_1.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.linuxday.torino_1.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.lucci.cm.greyscaletheme.verified.txt2017-01-11 17:28 36  
[TXT]it.lucci.cm.greyscaletheme_115.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.reyboz.bustorino_21.apk.verified.txt2017-05-10 22:40 36  
[TXT]it.reyboz.bustorino_22.apk.verified.txt2017-05-10 22:40 36  
[TXT]jpf.android.magiadni_9.apk.verified.txt2017-05-10 19:52 36  
[TXT]jpf.android.magiadni_10.apk.verified.txt2017-05-10 19:52 36  
[TXT]kiwi.root.an2linuxclient_4.apk.verified.txt2017-05-10 19:45 36  
[TXT]me.danielbarnett.addresstogps.verified.txt2017-01-11 14:19 36  
[TXT]me.danielbarnett.addresstogps_14.apk.verified.txt2017-05-10 02:39 36  
[TXT]me.johnmh.boogdroid_14.apk.verified.txt2017-05-10 02:36 36  
[TXT]me.kuehle.carreport.verified.txt2017-01-11 14:17 36  
[TXT]me.kuehle.carreport_52.apk.verified.txt2017-05-10 02:36 36  
[TXT]me.sheimi.sgit_110.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.shrimadhavuk.numselapp.verified.txt2017-01-11 14:15 36  
[TXT]me.shrimadhavuk.numselapp_1.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.shrimadhavuk.watransmitter.verified.txt2017-01-11 14:15 36  
[TXT]me.shrimadhavuk.watransmitter_3.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.zeeroooo.materialfb_42.apk.verified.txt2017-05-10 02:34 36  
[TXT]mobi.boilr.boilr_9.apk.verified.txt2017-05-10 02:25 36  
[TXT]moe.feng.nhentai_35.apk.verified.txt2017-05-10 02:18 36  
[TXT]name.seguri.android.getforegroundactivity_3.apk.verified.txt2017-05-10 02:04 36  
[TXT]net.bible.android.activity_216.apk.verified.txt2017-05-10 00:42 36  
[TXT]net.ddns.mlsoftlaberge.trycorder_513.apk.verified.txt2017-05-10 00:26 36  
[TXT]net.ddns.mlsoftlaberge.trycorder_518.apk.verified.txt2017-05-10 00:26 36  
[TXT]net.gaast.giggity_67.apk.verified.txt2017-05-10 00:22 36  
[TXT]net.kismetwireless.android.smarterwifimanager_85.apk.verified.txt2017-05-09 23:52 36  
[TXT]net.mabako.steamgifts_1005508.apk.verified.txt2017-05-09 23:49 36  
[TXT]net.mypapit.mobile.myposition_11.apk.verified.txt2017-05-09 22:42 36  
[TXT]net.pejici.summation_3.apk.verified.txt2017-05-15 14:37 36  
[TXT]net.sf.ethersynth_100.apk.verified.txt2017-05-15 13:59 36  
[TXT]net.sourceforge.solitaire_cg_610.apk.verified.txt2017-05-15 13:46 36  
[TXT]net.sourceforge.solitaire_cg_705.apk.verified.txt2017-05-15 13:46 36  
[TXT]net.sourceforge.solitaire_cg_710.apk.verified.txt2017-05-15 13:46 36  
[TXT]nitezh.ministock_68.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_733.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_734.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_735.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_740.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_741.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.implode.regenalarm_40101.apk.verified.txt2017-05-15 13:24 36  
[TXT]nl.mpcjanssen.simpletask_3055.apk.verified.txt2017-05-15 13:24 36  
[TXT]nl.yoerinijs.notebuddy_1.apk.verified.txt2017-05-15 13:21 36  
[TXT]nl.yoerinijs.notebuddy_4.apk.verified.txt2017-05-15 13:21 36  
[TXT]nl.yoerinijs.notebuddy_7.apk.verified.txt2017-05-15 13:21 36  
[TXT]nodomain.freeyourgadget.gadgetbridge_86.apk.verified.txt2017-05-15 13:21 36  
[TXT]org.andstatus.app_204.apk.verified.txt2017-05-15 12:15 36  
[TXT]org.asdtm.fas_3.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.asnelt.derandom_10.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.asteroidos.sync_3.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.aykit.MyOwnNotes_11.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.bienvenidoainternet.app_12.apk.verified.txt2017-05-15 11:55 36  
[TXT]org.billthefarmer.crossword_102.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.currency_107.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.currency_108.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.scope_112.apk.verified.txt2017-05-15 11:33 36  
[TXT]org.billthefarmer.shorty_107.apk.verified.txt2017-05-15 11:32 36  
[TXT]org.billthefarmer.siggen_109.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.siggen_110.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.tuner_114.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.tuner_116.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.bitbatzen.wlanscanner_1.apk.verified.txt2017-05-15 11:30 36  
[TXT]org.domogik.domodroid13_32.apk.verified.txt2017-05-15 10:17 36  
[TXT]org.dyndns.sven_ola.debian_kit_6.apk.verified.txt2017-05-15 09:11 36  
[TXT]org.fastergps_14.apk.verified.txt2017-05-15 08:50 36  
[TXT]org.gateshipone.odyssey_16.apk.verified.txt2017-05-15 08:16 36  
[TXT]org.horaapps.leafpic_13.apk.verified.txt2017-05-15 07:37 36  
[TXT]org.hwyl.sexytopo_13.apk.verified.txt2017-05-15 07:37 36  
[TXT]org.icasdri.mather.verified.txt2017-01-11 03:05 36  
[TXT]org.icasdri.mather_203.apk.verified.txt2017-05-15 07:34 36  
[TXT]org.indywidualni.fblite_49.apk.verified.txt2017-05-15 07:31 36  
[TXT]org.jak_linux.dns66_9.apk.verified.txt2017-05-15 07:20 36  
[TXT]org.jfet.batsHIIT_6.apk.verified.txt2017-05-15 07:13 36  
[TXT]org.kde.kdeconnect_tp_1610.apk.verified.txt2017-05-15 07:02 36  
[TXT]org.legtux.m_316k.fortune_2.apk.verified.txt2017-05-15 06:59 36  
[TXT]org.liberty.android.fantastischmemo_223.apk.verified.txt2017-05-15 06:58 36  
[TXT]org.libreoffice.impressremote_19.apk.verified.txt2017-05-15 06:57 36  
[TXT]org.ligi.fast.verified.txt2017-01-11 02:38 36  
[TXT]org.ligi.fast_65.apk.verified.txt2017-05-15 06:54 36  
[TXT]org.ligi.fast_66.apk.verified.txt2017-05-15 06:54 36  
[TXT]org.ligi.ipfsdroid.verified.txt2017-01-11 02:37 36  
[TXT]org.ligi.ipfsdroid_7.apk.verified.txt2017-05-15 06:53 36  
[TXT]org.ligi.scr_31.apk.verified.txt2017-05-15 06:49 36  
[TXT]org.mcxa.zephyrlogger_1.apk.verified.txt2017-05-15 06:27 36  
[TXT]org.microg.nlp.backend.nominatim_20039.apk.verified.txt2017-05-15 06:25 36  
[TXT]org.ntpsync_12.apk.verified.txt2017-05-15 05:52 36  
[TXT]org.ocsinventoryng.android.agent_24.apk.verified.txt2017-05-15 05:49 36  
[TXT]org.openbmap.unifiedNlp_18.apk.verified.txt2017-05-15 05:28 36  
[TXT]org.openintents.flashlight_10015.apk.verified.txt2017-05-15 05:25 36  
[TXT]org.openintents.notepad_10084.apk.verified.txt2017-05-15 05:24 36  
[TXT]org.polaric.cyanogenmodchangelog_66.apk.verified.txt2017-05-15 04:49 36  
[TXT]org.pulpdust.lesserpad_38.apk.verified.txt2017-05-15 04:44 36  
[TXT]org.scoutant.blokish_19.apk.verified.txt2017-05-15 02:32 36  
[TXT]org.secuso.privacyfriendlyactivitytracker_5.apk.verified.txt2017-05-15 02:32 36  
[TXT]org.secuso.privacyfriendlynetmonitor_3.apk.verified.txt2017-05-15 02:30 36  
[TXT]org.secuso.privacyfriendlyruler_3.apk.verified.txt2017-05-15 02:28 36  
[TXT]org.sensors2.osc_2.apk.verified.txt2017-05-15 02:22 36  
[TXT]org.sensors2.pd_1.apk.verified.txt2017-05-15 02:22 36  
[TXT]org.sufficientlysecure.ical_56.apk.verified.txt2017-05-15 00:49 36  
[TXT]org.toulibre.capitoledulibre_10.apk.verified.txt2017-05-14 22:24 36  
[TXT]org.transdroid.search_30.apk.verified.txt2017-05-14 22:20 36  
[TXT]org.us.andriod_4.apk.verified.txt2017-05-14 19:51 36  
[TXT]org.voidsink.anewjkuapp_140053.apk.verified.txt2017-05-14 19:50 36  
[TXT]org.whitequark.sipcaller_1.apk.verified.txt2017-05-14 19:25 36  
[TXT]org.wikipedia_191.apk.verified.txt2017-05-14 19:19 36  
[TXT]org.xbmc.kore_15.apk.verified.txt2017-05-14 18:17 36  
[TXT]org.y20k.trackbook_8.apk.verified.txt2017-05-14 17:55 36  
[TXT]org.y20k.transistor_34.apk.verified.txt2017-05-14 17:55 36  
[TXT]org.zephyrsoft.checknetwork_5.apk.verified.txt2017-05-14 17:51 36  
[TXT]pk.contender.earmouse.verified.txt2017-01-10 17:37 36  
[TXT]pk.contender.earmouse_27.apk.verified.txt2017-05-14 17:48 36  
[TXT]player.efis.pfd_3.apk.verified.txt2017-05-14 16:34 36  
[TXT]player.efis.pfd_7.apk.verified.txt2017-05-14 16:34 36  
[TXT]ro.ciubex.dscautorename_90.apk.verified.txt2017-05-14 16:28 36  
[TXT]ryey.camcov_9.apk.verified.txt2017-05-14 02:35 36  
[TXT]se.anyro.nfc_reader_14.apk.verified.txt2017-05-14 02:34 36  
[TXT]se.anyro.nfc_reader_15.apk.verified.txt2017-05-14 02:34 36  
[TXT]streetwalrus.usbmountr_2.apk.verified.txt2017-05-14 01:30 36  
[TXT]streetwalrus.usbmountr_3.apk.verified.txt2017-05-14 01:30 36  
[TXT]swati4star.createpdf_1.apk.verified.txt2017-05-14 01:29 36  
[TXT]tf.nox.wifisetup_20160804.apk.verified.txt2017-05-14 01:24 36  
[TXT]tk.jordynsmediagroup.simpleirc.fdroid_19.apk.verified.txt2017-05-14 01:24 36  
[TXT]tkj.android.homecontrol.mythmote.verified.txt2017-01-10 12:48 36  
[TXT]tkj.android.homecontrol.mythmote_2908.apk.verified.txt2017-05-14 01:24 36  
[TXT]uk.co.ashtonbrsc.android.intentintercept.verified.txt2017-01-10 12:39 36  
[TXT]uk.co.ashtonbrsc.android.intentintercept_224.apk.verified.txt2017-05-14 01:15 36  
[TXT]uk.co.yahoo.p1rpp.calendartrigger_1.apk.verified.txt2017-05-14 00:25 36  
[TXT]us.lindanrandy.cidrcalculator.verified.txt2017-01-10 12:11 36  
[TXT]us.lindanrandy.cidrcalculator_125.apk.verified.txt2017-05-14 00:20 36  
[TXT]x653.bullseye_1.apk.verified.txt2017-05-14 00:19 36  
[TXT]za.co.lukestonehm.logicaldefence_20.apk.verified.txt2017-05-14 00:13 36  
[   ]An.stop.json2023-04-29 01:50 79  
[   ]ai.susi.json2023-04-29 01:56 79  
[   ]build-last-updated.json2024-05-29 17:17 79  
[   ]com.olam.json2023-04-26 17:44 79  
[   ]fr.seeks.json2023-05-19 07:39 79  
[   ]com.iyps.json2023-05-26 15:36 80  
[   ]org.tint.json2023-05-22 10:36 80  
[   ]app.intra.json2023-05-20 08:32 81  
[   ]com.glTron.json2023-04-27 15:39 81  
[   ]com.log28.json2023-04-27 05:03 81  
[   ]ir.hsn6.tpb.json2023-05-18 16:58 81  
[   ]jp.yhonda.json2023-05-18 12:18 81  
[   ]ryey.flock.json2023-05-22 00:39 81  
[   ]taco.scoop.json2023-05-21 20:43 81  
[   ]com.atr.hiit.json2023-05-24 04:37 82  
[   ]de.sigfood.json2023-05-19 23:03 82  
[   ]fm.a2d.sf.json2023-05-19 14:01 82  
[   ]fr.asterope.json2023-05-19 13:52 82  
[   ]io.neurolab.json2023-05-18 18:30 82  
[   ]me.lucky.red.json2023-06-05 06:42 82  
[   ]me.writeily.json2023-06-05 06:05 82  
[   ]org.basic.lg.json2023-05-16 21:02 82  
[   ]org.tasks.json2023-05-22 12:47 82  
[   ]ryey.camcov.json2023-05-22 00:44 82  
[   ]search.searx.json2023-05-22 00:37 82  
[   ]ch.citux.td.json2023-05-24 09:39 83  
[   ]com.deva.knot.json2023-06-05 09:06 83  
[   ]com.ogsdroid.json2023-04-26 17:43 83  
[   ]com.passcard.json2023-04-26 16:09 83  
[   ]com.polipoid.json2023-04-26 14:17 83  
[   ]eu.dfdx.jslab.json2023-06-02 09:25 83  
[   ]fr.syncarnet.json2023-05-19 07:37 83  
[   ]goo.TeaTimer.json2023-05-19 06:36 83  
[   ]me.lucky.wyfy.json2023-06-05 06:33 83  
[   ]org.jsl.shmp.json2023-05-28 21:33 83  
[   ]org.ntpsync.json2023-05-23 06:20 83  
[   ]org.sudowars.json2023-05-22 13:36 83  
[   ]rak.pixellwp.json2023-05-22 03:01 83  
[   ]budo.budoist.json2021-02-27 14:18 84  
[   ]com.ath0.rpn.json2023-06-05 11:16 84  
[   ]com.meteocool.json2023-04-27 02:05 84  
[   ]com.otago.open.json2023-04-26 17:08 84  
[   ]com.pindroid.json2023-04-26 15:12 84  
[   ]com.termux.gui.json2023-01-08 05:40 84  
[   ]eu.polarclock.json2023-05-19 15:37 84  
[   ]freemap.hikar.json2023-05-19 13:40 84  
[   ]inc.flide.vim8.json2023-05-19 03:24 84  
[   ]io.mrarm.irc.json2023-05-18 18:32 84  
[   ]me.lucky.vibe.json2023-05-17 23:57 84  
[   ]net.stargw.fx.json2023-06-04 12:14 84  
[   ]org.asdtm.fas.json2023-06-04 08:50 84  
[   ]org.ligi.scr.json2023-05-28 18:53 84  
[   ]org.mult.daap.json2023-05-28 13:19 84  
[   ]org.og8.a1tox.json2023-05-28 12:44 84  
[   ]org.tomdroid.json2023-05-22 10:15 84  
[   ]ro.mihai.tpt.json2023-05-22 02:41 84  
[   ]ru.ikkui.achie.json2023-05-22 01:32 84  
[   ]security.pEp.json2022-04-01 17:16 84  
[   ]sun.bob.leela.json2023-06-02 06:53 84  
[   ]tof.cv.mpp.json2023-06-03 06:39 84  
[   ]atm.nasaimages.json2023-04-29 00:12 85  
[   ]br.odb.knights.json2023-04-28 23:03 85  
[   ]com.aa.mynotes.json2023-05-27 10:20 85  
[   ]com.colnix.fta.json2023-04-28 07:31 85  
[   ]com.ei.bmicalc.json2023-06-03 12:26 85  
[   ]com.fullscreen.json2023-04-27 21:53 85  
[   ]com.mlkyh.hertz.json2023-05-27 08:42 85  
[   ]com.termux.boot.json2023-04-26 04:01 85  
[   ]com.u2fa.secur.json2023-04-26 00:18 85  
[   ]com.u17od.upm.json2021-03-09 01:05 85  
[   ]cos.premy.mines.json2023-05-12 05:08 85  
[   ]cri.sanity.json2023-05-11 23:53 85  
[   ]csci567.squeez.json2023-05-12 05:08 85  
[   ]damo.three.ie.json2023-05-11 20:16 85  
[   ]de.asmw.flindex.json2023-05-11 20:08 85  
[   ]de.bwl.lfdi.app.json2023-06-03 10:38 85  
[   ]de.jdsoft.law.json2023-05-20 02:59 85  
[   ]de.tadris.flang.json2023-05-19 21:43 85  
[   ]de.we.acaldav.json2023-05-19 19:16 85  
[   ]douzifly.list.json2023-05-19 17:34 85  
[   ]dudeofx.eval.json2023-05-19 17:29 85  
[   ]eu.ryuu.screeps.json2023-05-19 14:54 85  
[   ]gal.sli.singal.json2023-05-19 07:10 85  
[   ]hans.b.skewy1_0.json2023-05-19 06:27 85  
[   ]it.ecosw.dudo.json2023-05-18 16:03 85  
[   ]me.lucky.aodify.json2023-06-05 06:42 85  
[   ]ohm.quickdice.json2023-06-04 10:32 85  
[   ]org.droidupnp.json2023-05-29 03:12 85  
[   ]org.fastergps.json2023-06-03 08:30 85  
[   ]org.ironrabbit.json2023-05-28 22:16 85  
[   ]org.ligi.fast.json2023-05-28 19:22 85  
[   ]org.uaraven.e.json2023-05-22 09:02 85  
[   ]org.us.andriod.json2023-05-22 08:40 85  
[   ]org.vono.narau.json2023-05-22 07:51 85  
[   ]pro.dbro.bart.json2023-05-22 03:25 85  
[   ]ru.valle.btc.json2023-05-22 01:19 85  
[   ]space.bm835.pb.json2023-05-21 21:51 85  
[   ]tuioDroid.impl.json2023-05-21 19:21 85  
[   ]ch.fixme.cowsay.json2023-05-27 10:25 86  
[   ]co.loubo.icicle.json2023-04-28 20:50 86  
[   ]com.blippex.app.json2023-05-23 23:34 86  
[   ]com.corona_info.json2021-03-10 05:55 86  
[   ]com.geoquizfoss.json2023-01-09 19:23 86  
[   ]com.lligainterm.json2023-04-27 05:13 86  
[   ]com.politedroid.json2023-04-26 14:16 86  
[   ]com.sinpo.xnfc.json2023-04-26 08:02 86  
[   ]com.xinto.mauth.json2023-05-06 09:03 86  
[   ]com.yasfa.views.json2023-04-25 21:11 86  
[   ]de.csicar.ning.json2023-05-20 06:18 86  
[   ]de.hskl.contacts.json2023-05-20 03:01 86  
[   ]de.tui.itlogger.json2023-05-19 21:04 86  
[   ]hsware.HSTempo.json2023-05-19 05:48 86  
[   ]indrora.atomic.json2023-05-19 03:24 86  
[   ]io.hoppe.whohere.json2023-05-18 19:59 86  
[   ]it.faerb.crond.json2023-05-18 15:56 86  
[   ]libretasks.app.json2023-05-18 10:15 86  
[   ]lu.fisch.canze.json2023-05-18 09:54 86  
[   ]me.cgarcia.yarr.json2023-06-17 16:38 86  
[   ]me.lucky.catcher.json2023-06-05 06:42 86  
[   ]me.lucky.clipeus.json2023-06-24 10:41 86  
[   ]me.lucky.reactor.json2023-06-05 06:42 86  
[   ]naman14.timber.json2023-06-05 04:34 86  
[   ]org.ligi.ajsha.json2023-05-28 19:31 86  
[   ]org.ligi.faster.json2023-05-23 12:46 86  
[   ]org.macno.puma.json2023-05-23 09:40 86  
[   ]org.schabi.kiba.json2023-05-22 18:01 86  
[   ]org.windvolt.json2023-05-22 07:03 86  
[   ]sh.ikl.liteshort.json2023-05-21 23:43 86  
[   ]souch.smsbypass.json2023-06-03 06:47 86  
[   ]wiseguys.radar.json2023-06-02 06:34 86  
[   ]at.h4x.amsprung.json2023-04-29 00:17 87  
[   ]com.aragaer.jtt.json2023-06-05 11:17 87  
[   ]com.asdoi.mebis.json2023-06-10 11:09 87  
[   ]com.aurora.corona.json2023-06-05 11:15 87  
[   ]com.cax.pmk.ext.json2023-06-05 09:23 87  
[   ]com.cg.lrceditor.json2023-04-28 09:41 87  
[   ]com.cr5315.cfdc.json2023-06-05 09:13 87  
[   ]com.doomy.torch.json2023-04-28 04:04 87  
[   ]com.example.TTime.json2023-04-28 00:27 87  
[   ]com.isdp.trirose.json2023-04-27 10:38 87  
[   ]com.kaeruct.glxy.json2023-04-27 08:21 87  
[   ]com.lako.moclock.json2023-07-10 12:31 87  
[   ]com.matt.outfield.json2023-04-27 02:51 87  
[   ]com.oakley.fon.json2023-04-26 18:14 87  
[   ]com.phikal.regex.json2023-04-26 15:28 87  
[   ]com.phpsysinfo.json2023-04-26 15:24 87  
[   ]com.ruesga.rview.json2023-04-26 11:58 87  
[   ]com.tuyafeng.watt.json2023-04-26 00:24 87  
[   ]com.vwp.locdemo.json2023-04-25 22:36 87  
[   ]de.baswil.gctools.json2023-05-11 19:31 87  
[   ]dev.pesic.rpncalc.json2023-05-19 19:16 87  
[   ]edu.rit.csh.devin.json2023-05-19 17:06 87  
[   ]et.nWifiManager.json2023-05-19 16:41 87  
[   ]eu.veldsoft.kechi.json2023-05-19 14:30 87  
[   ]fr.s3i.pointeuse.json2023-05-19 07:45 87  
[   ]gal.sli.digalnet.json2023-05-19 07:15 87  
[   ]hu.vsza.adsdroid.json2023-05-19 05:13 87  
[   ]jp.forkhub.json2023-05-18 12:26 87  
[   ]last-updated.json2024-05-29 17:17 87  
[   ]livio.rssreader.json2023-05-18 09:54 87  
[   ]max.music_cyclon.json2023-05-18 01:43 87  
[   ]me.sheimi.sgit.json2023-06-22 07:37 87  
[   ]mobi.boilr.boilr.json2023-06-05 05:23 87  
[   ]mobi.meddle.wehe.json2023-06-05 05:15 87  
[   ]net.fercanet.LNM.json2023-06-04 22:54 87  
[   ]net.frju.verdure.json2022-03-20 16:10 87  
[   ]net.glsk.wpgen.json2023-07-04 07:45 87  
[   ]net.oschina.app.json2023-05-17 09:45 87  
[   ]org.akvo.rsr.up.json2023-05-16 22:35 87  
[   ]org.decsync.flym.json2023-05-15 18:46 87  
[   ]org.fdroid.nearby.json2023-05-29 02:16 87  
[   ]org.me.tvhguide.json2023-05-23 08:49 87  
[   ]org.sensorkraken.json2023-07-15 06:39 87  
[   ]org.tint.adblock.json2023-05-22 10:28 87  
[   ]org.toulibre.cdl.json2023-05-22 09:44 87  
[   ]ovh.ice.icecons.json2023-05-22 05:14 87  
[   ]pl.nkg.geokrety.json2023-05-22 03:36 87  
[   ]ryey.colorsniffer.json2023-05-22 00:44 87  
[   ]tk.superl2.xwifi.json2023-06-03 06:39 87  
[   ]town.robin.toadua.json2023-05-21 19:35 87  
[   ]verify-last-updated.json2024-05-29 17:17 87  
[   ]aarddict.android.json2023-01-11 02:44 88  
[   ]am.zoom.mbrowser.json2023-03-27 00:48 88  
[   ]am.zoom.mlauncher.json2023-03-27 00:48 88  
[   ]amirz.dngprocessor.json2023-04-29 01:51 88  
[   ]atitel.com.todoer.json2023-04-29 00:17 88  
[   ]by.yauhenl.gardine.json2023-04-28 22:54 88  
[   ]ca.fuwafuwa.kaku.json2023-06-05 11:29 88  
[   ]ch.seto.kanjirecog.json2023-04-28 21:20 88  
[   ]com.GTP.eveminer.json2023-04-27 14:53 88  
[   ]com.abitsinc.andr.json2023-04-28 20:33 88  
[   ]com.andrew.apollo.json2023-06-05 11:22 88  
[   ]com.android.music.json2023-05-24 05:45 88  
[   ]com.android.quake.json2023-06-09 12:55 88  
[   ]com.bagaturchess.json2023-06-05 11:10 88  
[   ]com.best.deskclock.json2023-05-24 00:33 88  
[   ]com.catalin.rivia.json2023-06-05 09:25 88  
[   ]com.dwak.lastcall.json2023-06-05 08:54 88  
[   ]com.flasskamp.subz.json2023-04-28 00:07 88  
[   ]com.grocerymanager.json2023-04-27 14:55 88  
[   ]com.gyorog.polycal.json2023-05-06 09:25 88  
[   ]com.hasi.hasid00r.json2023-04-27 13:57 88  
[   ]com.hexbit.rutmath.json2023-05-06 09:24 88  
[   ]com.ilm.sandwich.json2023-04-27 13:15 88  
[   ]com.james.status.json2023-04-27 10:29 88  
[   ]com.matoski.adbm.json2023-04-27 02:53 88  
[   ]com.miqote.brswp.json2023-04-27 01:45 88  
[   ]com.nima.demomusix.json2023-06-03 10:53 88  
[   ]com.nima.wikianime.json2023-05-27 08:41 88  
[   ]com.piratebayfree.json2023-04-26 15:04 88  
[   ]com.platypus.SAnd.json2023-04-26 14:35 88  
[   ]com.ringdroid.json2023-04-26 12:12 88  
[   ]com.rj.pixelesque.json2023-04-26 12:22 88  
[   ]com.series.anlight.json2023-04-26 10:35 88  
[   ]com.ten15.diyfish.json2023-04-26 04:10 88  
[   ]com.utyf.pmetro.json2023-04-25 23:15 88  
[   ]com.vedroid.events.json2023-04-25 23:05 88  
[   ]com.volosyukivan.json2023-04-25 22:42 88  
[   ]com.wentam.defcol.json2023-04-25 21:57 88  
[   ]cxa.gridwallpaper.json2023-05-11 23:46 88  
[   ]cz.harvie.northdog.json2023-05-11 22:37 88  
[   ]cz.hejl.chesswalk.json2023-05-11 22:39 88  
[   ]de.dm1ri.totalog.json2023-05-20 04:13 88  
[   ]de.kodejak.hashr.json2023-07-12 07:48 88  
[   ]de.monocles.social.json2023-05-20 00:15 88  
[   ]dmusiolik.pijaret.json2023-05-19 17:56 88  
[   ]eu.quelltext.gita.json2023-05-19 14:58 88  
[   ]eun.initialvolume.json2023-05-19 15:38 88  
[   ]fr.miximum.napply.json2023-05-19 08:27 88  
[   ]fr.odrevet.fujiten.json2023-05-19 07:53 88  
[   ]fr.renzo.wikipoff.json2023-05-19 07:45 88  
[   ]freemap.opentrail.json2023-05-19 13:41 88  
[   ]giraffine.dimmer.json2023-05-19 07:13 88  
[   ]git.rrgb.kinolog.json2023-05-19 06:55 88  
[   ]gr.ndre.scuttloid.json2023-05-19 06:27 88  
[   ]ir.mrahimy.conceal.json2023-05-18 16:58 88  
[   ]me.anuraag.grader.json2023-05-18 01:23 88  
[   ]me.ocv.partyup.json2023-06-05 06:22 88  
[   ]net.scintill.duotp.json2023-06-04 12:53 88  
[   ]net.sf.crypt.gort.json2023-06-04 12:53 88  
[   ]net.tevp.postcode.json2023-05-17 00:41 88  
[   ]org.baitmooth.snow.json2023-06-04 07:55 88  
[   ]org.bc_bd.mrwhite.json2023-06-04 07:54 88  
[   ]org.calantas.mygeo.json2023-06-02 07:56 88  
[   ]org.jfet.batsHIIT.json2023-05-23 15:17 88  
[   ]org.ncrmnt.nettts.json2023-05-28 13:14 88  
[   ]org.schabi.stethox.json2023-05-22 17:41 88  
[   ]org.t2.synconwifi.json2023-05-22 12:43 88  
[   ]org.zakky.memopad.json2023-05-22 05:38 88  
[   ]pl.lebihan.network.json2023-05-22 03:36 88  
[   ]pl.librus.client.json2023-05-22 04:48 88  
[   ]raele.concurseiro.json2023-05-22 03:05 88  
[   ]ru.natsuru.websdr.json2023-06-04 06:29 88  
[   ]se.norenh.rkfread.json2023-05-22 00:09 88  
[   ]sk.vx.connectbot.json2023-06-03 06:48 88  
[   ]us.feras.mdv.demo.json2023-05-21 18:21 88  
[   ]x653.all_in_gold.json2023-06-03 06:30 88  
[   ]app.seeneva.reader.json2023-04-29 01:26 89  
[   ]app.weatheroverview.json2023-04-29 00:59 89  
[   ]at.bitfire.cadroid.json2023-04-29 00:44 89  
[   ]awais.instagrabber.json2023-04-28 23:29 89  
[   ]be.norio.randomapp.json2023-04-28 23:22 89  
[   ]com.abast.homebot.json2023-04-28 20:42 89  
[   ]com.app.Zensuren.json2023-05-24 05:06 89  
[   ]com.arduia.expense.json2023-05-24 05:03 89  
[   ]com.boardgamegeek.json2023-06-05 11:05 89  
[   ]com.brackeys.ui.json2023-06-05 10:22 89  
[   ]com.chesire.pushie.json2023-06-05 09:20 89  
[   ]com.coste.syncorg.json2023-06-05 09:13 89  
[   ]com.dhaval.bookland.json2023-06-05 09:05 89  
[   ]com.dozuki.ifixit.json2023-04-28 03:32 89  
[   ]com.example.sshtry.json2023-04-28 00:38 89  
[   ]com.gcstar.viewer.json2023-04-27 21:31 89  
[   ]com.ginkel.hashit.json2023-04-27 20:04 89  
[   ]com.jmelzer.myttr.json2023-04-27 09:35 89  
[   ]com.julij.arsovreme.json2023-05-06 09:22 89  
[   ]com.m3sv.plainupnp.json2023-07-10 09:39 89  
[   ]com.midisheetmusic.json2023-04-27 02:05 89  
[   ]com.mridang.speedo.json2023-04-27 00:41 89  
[   ]com.nkanaev.comics.json2021-03-09 10:01 89  
[   ]com.pi.attestation.json2023-04-26 15:19 89  
[   ]com.pilockerstable.json2023-04-26 15:18 89  
[   ]com.poinsart.votar.json2023-04-26 14:22 89  
[   ]com.simplytranslate.json2023-04-26 08:01 89  
[   ]com.thesis.yokatta.json2023-04-26 03:56 89  
[   ]com.tioui.opensound.json2023-04-26 03:48 89  
[   ]com.tkton.wallet.json2023-05-27 08:30 89  
[   ]com.tmendes.dadosd.json2023-04-26 03:27 89  
[   ]com.turtleplayerv2.json2023-04-26 02:16 89  
[   ]cs4295.memecreator.json2023-05-12 00:08 89  
[   ]de.csicar.mensaplan.json2023-05-20 06:18 89  
[   ]de.cyberit.wasgeht.json2023-05-20 06:12 89  
[   ]de.perflyst.untis.json2023-05-19 23:59 89  
[   ]de.tcrass.minos.json2023-05-19 21:33 89  
[   ]de.toshsoft.tsvnc.json2023-05-19 21:19 89  
[   ]es.ideotec.wdnotes.json2023-05-19 16:58 89  
[   ]eu.tilk.cdlcplayer.json2023-05-19 14:43 89  
[   ]fr.byped.bwarearea.json2023-05-19 13:43 89  
[   ]fr.hnit.riverferry.json2023-05-19 08:46 89  
[   ]io.github.hasheazy.json2023-05-19 00:53 89  
[   ]io.github.saveastxt.json2023-05-18 23:17 89  
[   ]io.github.silinote.json2023-05-18 23:11 89  
[   ]io.github.x0b.rcx.json2023-05-18 21:57 89  
[   ]io.lbry.browser.json2023-05-18 18:35 89  
[   ]it.langolonerd.app.json2023-05-18 15:40 89  
[   ]it.linuxday.torino.json2023-05-18 15:40 89  
[   ]jp.muo.syncmemories.json2023-05-18 12:20 89  
[   ]jp.takke.cpustats.json2023-05-18 12:19 89  
[   ]koeln.mop.elpeefpe.json2023-05-18 11:53 89  
[   ]makeinfo.com.getid.json2023-05-18 09:47 89  
[   ]moe.dic1911.autodnd.json2023-05-17 21:34 89  
[   ]net.cyclestreets.json2023-05-17 13:58 89  
[   ]net.ibbaa.keepitup.json2023-07-01 21:25 89  
[   ]net.tapi.handynotes.json2023-06-04 11:48 89  
[   ]net.tjado.usbgadget.json2023-06-04 11:40 89  
[   ]org.aja.flightmode.json2023-07-05 08:38 89  
[   ]org.appsroid.fxpro.json2023-05-16 21:53 89  
[   ]org.balau.fakedawn.json2023-05-16 21:03 89  
[   ]org.c_base.c_beam.json2023-05-15 20:44 89  
[   ]org.dianqk.ruslin.json2023-05-23 22:19 89  
[   ]org.diygenomics.pg.json2023-05-29 03:35 89  
[   ]org.dpadgett.timer.json2023-05-29 03:30 89  
[   ]org.droidtr.termbin.json2023-05-29 03:20 89  
[   ]org.ethack.orwall.json2023-05-29 02:42 89  
[   ]org.example.rosary.json2023-05-23 20:42 89  
[   ]org.happysanta.gd.json2023-05-23 16:44 89  
[   ]org.ietf.ietfsched.json2023-05-23 15:53 89  
[   ]org.kristbaum.como.json2023-05-28 19:48 89  
[   ]org.ligi.fahrplan.json2023-05-28 19:23 89  
[   ]org.mcxa.softsound.json2023-05-23 08:56 89  
[   ]org.microg.nlp.json2023-05-28 15:40 89  
[   ]org.openlp.android.json2023-05-28 10:25 89  
[   ]org.pyneo.maps.json2023-05-23 00:40 89  
[   ]org.qii.weiciyuan.json2023-05-25 06:41 89  
[   ]org.sagemath.droid.json2023-05-22 18:10 89  
[   ]org.twelf.cmtheme.json2023-05-22 09:03 89  
[   ]ru.exlmoto.snood21.json2023-05-22 02:36 89  
[   ]site.xiaocao.pixiv.json2023-06-02 07:00 89  
[   ]steele.gerry.dotty.json2023-05-21 21:48 89  
[   ]szelok.app.twister.json2023-06-03 06:44 89  
[   ]timur.webrtc.check.json2023-05-21 20:13 89  
[   ]trikita.talalarmo.json2023-05-21 19:32 89  
[   ]x1125io.initdlight.json2023-06-03 06:30 89  
[   ]SpeedoMeterApp.main.json2023-03-16 22:40 90  
[   ]at.finderlein.noe.json2023-07-13 08:56 90  
[   ]ca.mimic.apphangar.json2023-04-28 22:41 90  
[   ]com.Pau.ImapNotes2.json2023-04-26 16:05 90  
[   ]com.amanoteam.unalix.json2023-04-28 19:59 90  
[   ]com.autismprime.fall.json2023-06-05 11:15 90  
[   ]com.bri1.soundbored2.json2023-06-05 10:09 90  
[   ]com.chmod0.manpages.json2023-06-03 16:32 90  
[   ]com.drodin.tuxrider.json2023-06-03 12:45 90  
[   ]com.f2prateek.dfg.json2021-03-10 00:53 90  
[   ]com.hermit.btreprap.json2023-04-27 13:35 90  
[   ]com.hexad.bluezime.json2023-04-27 13:34 90  
[   ]com.jiaqifeng.hacki.json2023-05-26 15:35 90  
[   ]com.juet.attendance.json2023-07-10 14:34 90  
[   ]com.ketanolab.nusimi.json2023-05-06 09:21 90  
[   ]com.klee.volumelockr.json2023-04-27 07:46 90  
[   ]com.kpstv.xclipper.json2023-04-27 07:44 90  
[   ]com.metallic.chiaki.json2023-04-27 02:05 90  
[   ]com.miqote.shanawp.json2023-04-27 01:41 90  
[   ]com.nexes.manager.json2023-04-26 23:55 90  
[   ]com.nextgis.mobile.json2023-04-26 21:19 90  
[   ]com.nima.taskmanager.json2023-05-23 23:03 90  
[   ]com.oF2pks.neolinker.json2023-04-26 17:44 90  
[   ]com.orphan.amplayer.json2023-04-26 17:13 90  
[   ]com.pvcodes.debtcalc.json2023-04-26 13:25 90  
[   ]com.rohit2810.spotit.json2023-04-26 12:01 90  
[   ]com.sound.ampache.json2023-04-26 07:51 90  
[   ]com.teleca.jamendo.json2023-04-26 04:13 90  
[   ]com.thesuncat.sudoku.json2023-06-02 09:42 90  
[   ]com.tjk104.openfndds.json2023-04-26 03:43 90  
[   ]com.tjm.stripepaper.json2023-04-26 03:32 90  
[   ]com.traffar.a24game.json2023-04-26 02:25 90  
[   ]com.traffar.pentago.json2023-04-26 02:21 90  
[   ]cxa.lineswallpaper.json2023-05-11 23:45 90  
[   ]cz.antecky.netswitch.json2023-05-11 22:40 90  
[   ]de.feisar.wordvalue.json2023-05-20 03:44 90  
[   ]de.k3b.android.calef.json2023-05-20 02:20 90  
[   ]de.mangelow.balance.json2023-05-20 01:39 90  
[   ]de.nico.ha_manager.json2023-05-20 00:11 90  
[   ]de.ph1b.audiobook.json2023-05-19 23:54 90  
[   ]de.steinpfeffer.rdt.json2023-05-19 22:49 90  
[   ]eu.domob.anacam.json2023-05-19 16:39 90  
[   ]eu.veldsoft.scribe4.json2023-05-10 23:30 90  
[   ]fr.rhaz.ipfs.sweet.json2023-05-19 07:53 90  
[   ]in.tosc.remotedroid.json2023-05-19 02:16 90  
[   ]io.github.aoc_normal.json2023-06-02 09:19 90  
[   ]io.github.hopedia.json2023-05-19 00:52 90  
[   ]is.xyz.omw_nightly.json2023-05-18 16:54 90  
[   ]it.iiizio.epubator.json2023-05-18 15:49 90  
[   ]me.phh.superuser.json2023-06-05 06:22 90  
[   ]mobi.cyann.nstools.json2023-05-17 21:59 90  
[   ]net.asceai.meritous.json2023-06-04 23:42 90  
[   ]net.bluetoothviewer.json2023-06-04 23:16 90  
[   ]net.pejici.easydice.json2023-06-04 19:15 90  
[   ]net.sf.ethersynth.json2023-06-04 12:52 90  
[   ]org.addhen.smssync.json2022-03-19 23:32 90  
[   ]org.ligi.ipfsdroid.json2023-05-23 12:46 90  
[   ]org.openlp.android2.json2023-05-28 09:06 90  
[   ]org.piwigo.android.json2023-05-28 07:27 90  
[   ]org.shirakumo.ocelot.json2023-05-22 16:16 90  
[   ]org.wentura.getflow.json2023-05-22 07:21 90  
[   ]org.xapek.andiodine.json2023-05-22 06:17 90  
[   ]org.zimmob.zimlx.json2023-05-22 05:23 90  
[   ]press.condense.www.json2023-05-22 03:27 90  
[   ]ru.zxalexis.ugaday.json2023-05-22 00:46 90  
[   ]se.leap.riseupvpn.json2023-06-03 06:27 90  
[   ]simbio.se.nheengare.json2023-05-21 23:43 90  
[   ]za.co.neilson.alarm.json2023-06-03 06:27 90  
[   ]app.fedilab.mobilizon.json2023-04-29 01:45 91  
[   ]at.univie.sensorium.json2023-04-06 18:56 91  
[   ]be.geecko.QuickLyric.json2023-04-28 23:26 91  
[   ]buet.rafi.dictionary.json2023-04-28 23:00 91  
[   ]ca.ramzan.virtuosity.json2023-04-28 22:39 91  
[   ]cc.rainwave.android.json2023-04-28 22:19 91  
[   ]click.dummer.yidkey.json2023-05-27 10:21 91  
[   ]com.SecUpwN.AIMSICD.json2023-04-26 10:45 91  
[   ]com.a5corp.weather.json2023-05-27 10:20 91  
[   ]com.angryburg.uapp.json2023-06-05 11:20 91  
[   ]com.bec3.diolite.json2023-06-03 21:15 91  
[   ]com.berdik.macsposed.json2023-05-24 00:46 91  
[   ]com.blanyal.remindly.json2023-06-05 11:06 91  
[   ]com.cleveroad.sample.json2023-04-28 08:07 91  
[   ]com.code61.deadpixel.json2023-06-05 09:19 91  
[   ]com.dftec.planetcon.json2023-06-05 09:06 91  
[   ]com.dnielfe.manager.json2023-06-05 09:00 91  
[   ]com.easwareapps.g2l.json2023-06-05 08:53 91  
[   ]com.example.CosyDVR.json2023-04-28 00:55 91  
[   ]com.example.dozencalc.json2023-04-28 00:54 91  
[   ]com.example.openpass.json2023-04-28 00:40 91  
[   ]com.github.gotify.up.json2023-04-27 17:51 91  
[   ]com.gladis.tictactoe.json2021-03-09 21:07 91  
[   ]com.glanznig.beepme.json2023-04-27 15:40 91  
[   ]com.gluege.nightlight.json2023-04-27 15:38 91  
[   ]com.horaapps.leafpic.json2023-04-27 13:32 91  
[   ]com.iazasoft.footguy.json2023-04-27 13:20 91  
[   ]com.infomaniak.meet.json2023-05-06 09:24 91  
[   ]com.jellyshack.block6.json2023-04-27 10:01 91  
[   ]com.jtechme.jumpgo.json2023-04-27 08:36 91  
[   ]com.kaeruct.gotosleep.json2023-04-27 08:08 91  
[   ]com.kure.musicplayer.json2023-04-27 07:11 91  
[   ]com.libopenmw.openmw.json2023-04-27 06:26 91  
[   ]com.lun.chin.aicamera.json2023-04-27 04:35 91  
[   ]com.markusborg.test.json2023-04-27 03:18 91  
[   ]com.mridang.cellinfo.json2021-03-09 11:51 91  
[   ]com.mridang.throttle.json2023-04-27 00:41 91  
[   ]com.mridang.wifiinfo.json2021-03-09 11:46 91  
[   ]com.nephoapp.anarxiv.json2023-04-26 23:58 91  
[   ]com.quaap.audiometer.json2023-04-26 13:28 91  
[   ]com.serwylo.babybook.json2023-04-26 10:35 91  
[   ]com.shadcat.secdroid.json2023-04-26 10:11 91  
[   ]com.team242.robozzle.json2023-04-26 04:13 91  
[   ]com.tomer.alwayson.json2023-04-26 02:31 91  
[   ]com.tomer.dbz.widget.json2023-04-26 02:31 91  
[   ]com.vlath.keyboard.json2023-04-25 22:45 91  
[   ]com.wrmndfzzy.atomize.json2023-04-25 21:29 91  
[   ]com.x1unix.s60icons.json2021-03-08 21:52 91  
[   ]com.xabber.android.json2023-04-25 21:36 91  
[   ]cx.vmx.sdcontacts.json2023-05-11 22:44 91  
[   ]de.beocode.bestbefore.json2023-06-05 08:21 91  
[   ]de.foodsharing.app.json2023-12-14 18:31 91  
[   ]de.k4ever.k4android.json2023-05-20 02:18 91  
[   ]de.schlikk.calls.json2023-05-19 23:07 91  
[   ]de.thecode.lmd.json2023-05-19 21:31 91  
[   ]de.tum.in.tumcampus.json2023-05-19 20:25 91  
[   ]eu.devunit.fb_client.json2023-05-19 16:39 91  
[   ]eu.domob.bjtrainer.json2023-05-19 16:38 91  
[   ]eu.quelltext.counting.json2023-05-26 08:51 91  
[   ]eu.veldsoft.tri.peaks.json2023-05-19 14:28 91  
[   ]fil.libre.repwifiapp.json2023-05-19 14:03 91  
[   ]fly.speedmeter.grub.json2023-05-19 14:01 91  
[   ]fr.keuse.rightsalert.json2023-05-19 08:40 91  
[   ]fr.masciulli.drinks.json2023-05-19 08:32 91  
[   ]fr.s13d.photobackup.json2023-05-19 07:46 91  
[   ]fr.twentynine.keepon.json2023-05-19 07:36 91  
[   ]free.rm.netcfgwidget.json2023-05-19 13:40 91  
[   ]home.jmstudios.calc.json2023-05-19 06:26 91  
[   ]im.vector.app.json2022-02-05 10:39 91  
[   ]in.digistorm.aksharam.json2023-06-02 01:18 91  
[   ]info.frangor.laicare.json2023-05-19 03:10 91  
[   ]io.github.folderlogs.json2023-05-19 01:16 91  
[   ]is.binary.alcoholnow.json2023-05-18 17:16 91  
[   ]kr.hybdms.sidepanel.json2023-05-18 12:01 91  
[   ]me.gloeckl.fallasleep.json2023-06-05 06:53 91  
[   ]me.johnmh.boogdroid.json2023-06-17 16:37 91  
[   ]me.mgerdes.open_golf.json2023-06-05 06:42 91  
[   ]ml.adamsprogs.bimba.json2023-06-05 05:41 91  
[   ]moe.martini.midictrl.json2023-05-17 21:31 91  
[   ]net.pejici.summation.json2023-06-04 14:09 91  
[   ]net.pherth.omnomagon.json2023-06-04 14:09 91  
[   ]net.phunehehe.foocam.json2023-06-04 13:36 91  
[   ]net.stkaddons.viewer.json2023-06-04 12:14 91  
[   ]net.xzos.upgradeall.json2023-06-04 11:00 91  
[   ]org.biotstoiq.seshat.json2023-07-05 08:28 91  
[   ]org.birthdayadapter.json2023-06-04 07:24 91  
[   ]org.blockinger.game.json2023-05-16 20:26 91  
[   ]org.dgtale.icsimport.json2023-05-15 18:18 91  
[   ]org.dyndns.fules.ck.json2023-05-23 21:15 91  
[   ]org.froscon.schedule.json2023-05-23 18:54 91  
[   ]org.icasdri.mather.json2023-05-28 22:19 91  
[   ]org.ligi.blexplorer.json2023-05-23 12:57 91  
[   ]org.servalproject.json2023-05-22 16:44 91  
[   ]org.thecongers.mtpms.json2023-05-22 11:23 91  
[   ]org.tw.onze.cmtheme.json2023-05-22 08:50 91  
[   ]org.xphnx.iconsubmit.json2023-05-22 05:55 91  
[   ]pl.hypeapp.endoscope.json2023-05-22 04:49 91  
[   ]pl.kuben.progressapp.json2023-05-22 03:42 91  
[   ]re.indigo.epistolaire.json2023-05-22 03:01 91  
[   ]ru.evgeniy.dpitunnel.json2023-05-22 02:36 91  
[   ]se.embargo.retroboy.json2023-05-22 00:32 91  
[   ]siir.es.adbWireless.json2023-05-22 00:04 91  
[   ]tube.chikichiki.sako.json2023-05-21 19:20 91  
[   ]aq.com.sharetobrowser.json2023-04-29 00:59 92  
[   ]asgardius.page.s3music.json2023-07-10 18:10 92  
[   ]at.tomtasche.reader.json2023-04-28 23:35 92  
[   ]au.com.darkside.xdemo.json2023-04-28 23:30 92  
[   ]axp.tool.apkextractor.json2023-04-28 23:28 92  
[   ]ca.andries.portknocker.json2023-04-28 22:54 92  
[   ]cat.pantsu.nyaapantsu.json2023-04-28 22:24 92  
[   ]ch.corona.tracing.json2023-04-28 21:59 92  
[   ]ch.cryptobit.letterbox.json2023-05-26 17:31 92  
[   ]ch.ihdg.calendarcolor.json2023-05-27 10:25 92  
[   ]click.dummer.rickapp.json2023-05-24 08:39 92  
[   ]com.alexkang.bluechat.json2023-04-28 20:02 92  
[   ]com.alxgnon.postwriter.json2023-04-28 19:59 92  
[   ]com.android.launcher3.json2023-06-08 12:19 92  
[   ]com.artikus.nolauncher.json2023-05-24 05:02 92  
[   ]com.bec3.mobilite.json2023-05-24 01:08 92  
[   ]com.biotstoiq.cryptix.json2023-06-05 11:07 92  
[   ]com.bleyl.recurrence.json2023-06-03 20:01 92  
[   ]com.bretternst.URLazy.json2023-06-05 10:21 92  
[   ]com.chooloo.www.koler.json2023-06-03 16:31 92  
[   ]com.color.colornamer.json2023-04-28 07:24 92  
[   ]com.cybrosys.palmcalc.json2023-06-05 09:10 92  
[   ]com.diblui.fullcolemak.json2023-06-05 09:05 92  
[   ]com.easwareapps.baria.json2023-06-05 08:53 92  
[   ]com.eventyay.attendee.json2023-04-28 00:57 92  
[   ]com.github.igrmk.smsq.json2023-04-27 17:36 92  
[   ]com.harr1424.listmaker.json2023-05-06 09:24 92  
[   ]com.irahul.worldclock.json2023-04-27 10:48 92  
[   ]com.jpwolfso.privdnsqt.json2023-04-27 08:44 92  
[   ]com.kaeruct.raumballer.json2023-04-27 08:08 92  
[   ]com.kolloware.wechange.json2023-07-10 13:10 92  
[   ]com.liato.bankdroid.json2023-04-27 05:38 92  
[   ]com.lyonbros.turtl.json2023-04-27 04:38 92  
[   ]com.mendhak.sheepyhorn.json2023-04-27 02:07 92  
[   ]com.merxury.blocker.json2023-06-03 10:54 92  
[   ]com.moonpi.tapunlock.json2023-04-27 01:00 92  
[   ]com.mustupid.metronome.json2023-04-27 00:28 92  
[   ]com.notriddle.budget.json2023-04-26 18:59 92  
[   ]com.qubling.sidekick.json2021-03-09 06:33 92  
[   ]com.quchen.flashcard.json2023-04-26 13:17 92  
[   ]com.rareventure.gps2.json2023-04-26 12:57 92  
[   ]com.reecedunn.espeak.json2023-04-26 12:38 92  
[   ]com.rigid.birthdroid.json2023-04-26 12:13 92  
[   ]com.sahdeepsingh.Bop.json2023-04-26 11:46 92  
[   ]com.serwylo.msjviewer.json2023-04-26 10:27 92  
[   ]com.shapps.mintubeapp.json2023-04-26 10:10 92  
[   ]com.simonramstedt.yoke.json2023-04-26 10:00 92  
[   ]com.timvdalen.gizmooi.json2023-04-26 03:49 92  
[   ]com.twidere.twiderex.json2023-04-26 00:30 92  
[   ]com.zzzmode.appopsx.json2023-05-12 05:13 92  
[   ]de.delusions.measure.json2023-05-20 04:54 92  
[   ]de.hfu.funfpunktnull.json2023-05-20 03:03 92  
[   ]de.hoffmannsgimmicks.json2023-05-20 03:03 92  
[   ]de.mangelow.syncwifi.json2023-05-20 01:39 92  
[   ]de.meonwax.soundboard.json2023-07-15 07:40 92  
[   ]de.vibora.viborafeed.json2023-05-19 19:42 92  
[   ]deltazero.amarok.foss.json2023-06-03 10:35 92  
[   ]dev.atahabaki.wordbook.json2023-05-19 20:05 92  
[   ]dev.danjackson.speaker.json2023-06-05 08:13 92  
[   ]dev.jtsalva.cloudmare.json2023-05-19 19:41 92  
[   ]eu.auct.twitter2nitter.json2023-06-03 10:27 92  
[   ]eu.droogers.smsmatrix.json2023-05-19 16:37 92  
[   ]eu.halaser.beamctrl.json2023-05-19 16:15 92  
[   ]eu.siebeck.sipswitch.json2023-05-19 14:45 92  
[   ]eu.veldsoft.brainstonz.json2023-05-19 14:36 92  
[   ]eu.veldsoft.vitoshadm.json2023-05-19 14:29 92  
[   ]fr.bepo.clavierexterne.json2023-05-19 13:42 92  
[   ]fr.mobdev.peertubelive.json2023-05-19 08:21 92  
[   ]github.yaa110.memento.json2023-05-19 06:53 92  
[   ]github.yaa110.piclice.json2023-05-19 07:10 92  
[   ]ie.defo.ech_apps.json2023-05-19 05:12 92  
[   ]info.aario.killcamera.json2023-05-19 03:22 92  
[   ]it.rgp.nyagua.pafcalc.json2023-05-18 13:31 92  
[   ]jackpal.droidexaminer.json2023-05-18 13:23 92  
[   ]kuesji.link_eye.fdroid.json2023-05-18 11:51 92  
[   ]me.yardenac.comaphone.json2023-06-05 05:59 92  
[   ]mohammad.adib.roundr.json2023-06-24 10:32 92  
[   ]nds.fyll.puzzle_grid.json2023-06-05 04:10 92  
[   ]net.foucry.pilldroid.json2023-06-04 22:53 92  
[   ]net.pmarks.chromadoze.json2023-06-04 13:35 92  
[   ]net.turtton.ytalarm.json2023-06-04 11:33 92  
[   ]net.vreeken.quickmsg.json2023-06-04 11:25 92  
[   ]one.librem.chat.json2023-05-16 23:40 92  
[   ]org.aykit.MyOwnNotes.json2023-06-04 07:57 92  
[   ]org.bibledit.android.json2023-07-04 07:08 92  
[   ]org.booncode.bluepass4.json2023-06-04 06:51 92  
[   ]org.chrisbailey.todo.json2023-05-15 20:39 92  
[   ]org.dynalogin.android.json2023-05-29 03:09 92  
[   ]org.eukalyptus.balance.json2023-05-23 20:43 92  
[   ]org.glucosio.android.json2023-05-29 00:03 92  
[   ]org.horaapps.leafpic.json2023-05-23 16:00 92  
[   ]org.itxtech.daedalus.json2023-05-23 15:31 92  
[   ]org.mcxa.zephyrlogger.json2023-05-23 08:56 92  
[   ]org.nv95.openmanga.json2023-05-28 12:43 92  
[   ]org.safecoin.safeprice.json2023-05-23 00:16 92  
[   ]org.systemcall.scores.json2023-05-22 12:56 92  
[   ]org.voidptr.swpieview.json2023-05-22 07:57 92  
[   ]org.yausername.dvd.json2023-05-22 05:48 92  
[   ]ru.equestriadev.mgke.json2022-04-01 21:04 92  
[   ]ru.henridellal.patolli.json2023-05-22 01:35 92  
[   ]ru.hugeping.reinstead.json2023-05-22 01:37 92  
[   ]ru.ttyh.neko259.notey.json2023-05-22 01:21 92  
[   ]se.johanhil.clipboard.json2023-05-22 00:19 92  
[   ]tech.techlore.plexus.json2023-06-01 20:04 92  
[   ]tk.al54.dev.badpixels.json2023-07-11 06:31 92  
[   ]ua.gardenapple.trylbry.json2023-05-21 19:14 92  
[   ]cc.co.eurdev.urecorder.json2023-04-28 22:23 93  
[   ]ch.tiim.markdown_widget.json2023-06-05 11:27 93  
[   ]com.addismaptransit.app.json2023-04-28 20:31 93  
[   ]com.ancantus.HYPNOTOAD.json2023-04-28 19:58 93  
[   ]com.beem.project.beem.json2023-05-24 01:06 93  
[   ]com.brianco.colorclock.json2023-06-05 10:10 93  
[   ]com.ciarang.tallyphant.json2023-06-03 16:31 93  
[   ]com.csmarosi.wifiautoff.json2023-04-28 06:58 93  
[   ]com.doplgangr.secrecy.json2023-06-05 08:57 93  
[   ]com.easwareapps.quoter.json2023-06-05 08:54 93  
[   ]com.easytarget.micopi.json2023-06-05 08:53 93  
[   ]com.enrico.filemanager.json2023-04-28 01:54 93  
[   ]com.eolwral.osmonitor.json2023-06-03 11:33 93  
[   ]com.example.siete_media.json2023-04-28 00:39 93  
[   ]com.finnmglas.launcher.json2023-04-28 00:08 93  
[   ]com.hanntech.free2pass.json2023-04-27 14:02 93  
[   ]com.health.openworkout.json2023-04-27 13:35 93  
[   ]com.javierllorente.adc.json2023-04-27 10:14 93  
[   ]com.kazispin.money_logs.json2023-06-05 08:39 93  
[   ]com.luorrak.ouroboros.json2023-04-27 04:36 93  
[   ]com.moonpi.swiftnotes.json2023-04-27 00:43 93  
[   ]com.mustupid.pitch_pipe.json2023-04-27 00:28 93  
[   ]com.nbossard.packlist.json2023-04-27 00:12 93  
[   ]com.rafapps.simplenotes.json2023-06-02 01:44 93  
[   ]com.sagar.screenshift2.json2023-04-26 11:58 93  
[   ]com.secuso.torchlight2.json2023-04-26 10:38 93  
[   ]com.shurik.droidzebra.json2023-04-26 10:09 93  
[   ]com.sovworks.edslite.json2023-04-26 07:54 93  
[   ]com.soyblue.bluesound.json2023-04-26 07:52 93  
[   ]com.stonegate.tsacdop.json2023-04-26 05:24 93  
[   ]com.th.XenonWallpapers.json2023-04-26 03:51 93  
[   ]com.tmarki.comicmaker.json2023-04-26 03:35 93  
[   ]com.yubico.yubiclip.json2023-04-25 21:05 93  
[   ]de.com.quaap.primary.json2023-05-20 06:19 93  
[   ]de.deftk.openww.android.json2023-05-20 04:52 93  
[   ]de.digisocken.reotwe.json2023-05-20 04:14 93  
[   ]de.dotwee.micropinner.json2023-05-20 04:36 93  
[   ]de.pinyto.exalteddicer.json2023-05-19 23:53 93  
[   ]de.rmrf.partygames.json2023-05-19 23:24 93  
[   ]de.sensebox.blockly.json2023-05-19 23:07 93  
[   ]de.srlabs.snoopsnitch.json2023-05-19 22:54 93  
[   ]eu.dartstrainer.app.twa.json2023-05-19 16:41 93  
[   ]eu.pretix.pretixdroid.json2023-05-19 15:41 93  
[   ]eu.veldsoft.fish.rings.json2023-05-19 14:35 93  
[   ]fr.bux.rollingdashboard.json2023-05-19 13:42 93  
[   ]fr.xtof54.dragonGoApp.json2023-05-19 07:18 93  
[   ]im.vector.riotx.json2023-05-19 04:23 93  
[   ]io.dahliaos.calculator.json2023-06-03 10:21 93  
[   ]io.github.installalogs.json2023-05-19 00:50 93  
[   ]io.github.mthli.Ninja.json2023-05-19 00:09 93  
[   ]io.treehouses.remote.json2023-05-18 17:44 93  
[   ]julianwi.javainstaller.json2023-05-18 12:17 93  
[   ]kr.softgear.multiping.json2023-05-18 11:52 93  
[   ]m.co.rh.id.a_medic_log.json2023-05-23 22:34 93  
[   ]mixedbit.speechtrainer.json2023-06-05 05:59 93  
[   ]net.androidcomics.acv.json2023-05-17 15:25 93  
[   ]net.bmaron.openfixmap.json2023-06-04 23:15 93  
[   ]net.bytten.xkcdviewer.json2023-06-04 23:14 93  
[   ]net.chilon.matt.teacup.json2023-06-04 23:12 93  
[   ]net.mcarolan.whenzebus.json2023-06-04 21:24 93  
[   ]nya.kitsunyan.foxydroid.json2023-06-04 10:34 93  
[   ]org.alberto97.aodtoggle.json2023-05-16 22:34 93  
[   ]org.asdtm.goodweather.json2023-05-16 21:49 93  
[   ]org.ciasaboark.tacere.json2023-05-15 20:41 93  
[   ]org.durka.hallmonitor.json2023-05-29 03:19 93  
[   ]org.flyve.mdm.agent.json2023-05-23 20:06 93  
[   ]org.github.OxygenGuide.json2023-05-29 00:52 93  
[   ]org.irmacard.cardemu.json2023-05-23 15:49 93  
[   ]org.mazhuang.guanggoo.json2023-05-28 16:16 93  
[   ]org.opengemara.shiurim.json2023-05-28 12:32 93  
[   ]org.schabi.svgredirect.json2023-05-22 17:43 93  
[   ]ru.evgeniy.dpitunnelcli.json2023-05-22 02:36 93  
[   ]ru.henridellal.fsassist.json2023-05-22 01:35 93  
[   ]space.kraut.schluessel.json2023-06-01 21:04 93  
[   ]sushi.hardcore.droidfs.json2023-06-03 06:45 93  
[   ]systems.now8.app.json2023-06-02 06:51 93  
[   ]ut.ewh.audiometrytest.json2023-06-03 06:33 93  
[   ]agersant.polaris.json2023-04-29 01:56 94  
[   ]at.zweng.bankomatinfos.json2023-04-28 23:34 94  
[   ]audio.funkwhale.ffa.json2023-04-28 23:30 94  
[   ]br.usp.ime.retrobreaker.json2023-04-28 23:01 94  
[   ]com.abh80.smartedge.json2023-05-06 09:46 94  
[   ]com.actisec.clipcaster.json2023-06-10 11:18 94  
[   ]com.agateau.catgenerator.json2023-04-28 20:25 94  
[   ]com.akshayaap.touchdroid.json2023-07-15 08:45 94  
[   ]com.artifex.mupdfdemo.json2023-06-04 00:28 94  
[   ]com.eventyay.organizer.json2021-03-10 01:18 94  
[   ]com.example.dozenalclock.json2023-04-28 00:54 94  
[   ]com.example.poleidoscope.json2023-04-28 00:39 94  
[   ]com.foxykeep.lifecounter.json2021-03-10 00:30 94  
[   ]com.geecko.QuickLyric.json2023-04-27 21:42 94  
[   ]com.haha01haha01.harail.json2023-04-27 14:05 94  
[   ]com.jkcarino.ankieditor.json2023-04-27 09:36 94  
[   ]com.lloydtorres.stately.json2023-04-27 05:01 94  
[   ]com.lucasdnd.bitclock16.json2023-04-27 04:40 94  
[   ]com.macpoule.plantsense.json2023-06-03 10:56 94  
[   ]com.matburt.mobileorg.json2023-04-27 03:10 94  
[   ]com.materialos.cm.theme.json2023-04-27 02:53 94  
[   ]com.money.manager.ex.json2021-03-09 12:42 94  
[   ]com.nanoconverter.zlab.json2023-04-27 00:15 94  
[   ]com.onest8.onetimepad.json2023-04-26 17:28 94  
[   ]com.philliphsu.clock2.json2023-04-26 15:24 94  
[   ]com.quaap.phonefonefun.json2023-04-26 13:16 94  
[   ]com.scraperclub.android.json2023-04-26 11:18 94  
[   ]com.sentienhq.launcher.json2023-04-26 10:35 94  
[   ]com.sirekanyan.knigopis.json2023-04-26 08:01 94  
[   ]com.syncedsynapse.kore2.json2023-04-26 04:57 94  
[   ]com.templaro.opsiz.aka.json2023-04-26 04:09 94  
[   ]com.truchsess.send2car.json2023-04-26 02:17 94  
[   ]com.umang.dashnotifier.json2023-04-26 00:09 94  
[   ]com.veken0m.bitcoinium.json2023-04-25 23:05 94  
[   ]com.wesaphzt.privatelock.json2023-04-25 21:56 94  
[   ]com.woefe.shoppinglist.json2023-04-25 21:51 94  
[   ]com.zfdang.touchhelper.json2023-05-06 05:41 94  
[   ]community.peers.license.json2023-04-27 00:30 94  
[   ]de.andicodes.vergissnix.json2023-05-11 20:12 94  
[   ]de.drmaxnix.futharkboard.json2023-06-05 08:20 94  
[   ]de.jurihock.voicesmith.json2023-05-20 02:31 94  
[   ]de.mangelow.slideitloud.json2023-05-20 01:39 94  
[   ]de.mangelow.throughput.json2023-05-20 01:39 94  
[   ]de.onyxbits.geobookmark.json2023-05-20 00:04 94  
[   ]de.westnordost.luftlinie.json2023-05-19 19:15 94  
[   ]eu.zimbelstern.tournant.json2023-07-14 07:30 94  
[   ]in.ac.dducollegedu.shell.json2023-05-19 03:55 94  
[   ]io.github.datastopwatch.json2023-05-19 01:38 94  
[   ]io.github.ismywebsiteup.json2023-05-19 00:50 94  
[   ]io.github.yamin8000.dooz.json2023-05-18 21:57 94  
[   ]it.mn.salvi.linuxDayOSM.json2023-05-18 15:46 94  
[   ]jp.co.omronsoft.openwnn.json2023-05-18 12:41 94  
[   ]jp.ksksue.app.terminal.json2023-05-18 12:25 94  
[   ]m.co.rh.id.a_flash_deck.json2023-05-18 01:34 94  
[   ]moe.lz233.unvcode.json2023-06-05 05:11 94  
[   ]name.lmj001.savetodevice.json2023-05-17 20:29 94  
[   ]net.czlee.debatekeeper.json2023-06-04 23:12 94  
[   ]net.gsantner.dandelior.json2023-06-04 22:45 94  
[   ]net.haltcondition.anode.json2023-06-04 22:27 94  
[   ]net.logomancy.diedroid.json2023-07-01 21:24 94  
[   ]net.solutinno.websearch.json2023-05-17 01:44 94  
[   ]net.sourceforge.andsys.json2023-05-17 01:41 94  
[   ]one.librem.tunnel.json2023-05-21 08:55 94  
[   ]org.aminb.mathtools.app.json2023-06-04 09:33 94  
[   ]org.berlin_vegan.bvapp.json2023-05-16 21:01 94  
[   ]org.biotstoiq.gophercle.json2023-05-16 20:33 94  
[   ]org.cipherdyne.fwknop2.json2023-05-15 20:36 94  
[   ]org.gnucash.android.json2023-05-29 00:12 94  
[   ]org.hiittimer.hiittimer.json2023-05-28 23:00 94  
[   ]org.holylobster.nuntius.json2023-05-23 16:00 94  
[   ]org.jschwab.openrecipes.json2023-05-28 21:34 94  
[   ]org.libre.agosto.p2play.json2023-05-28 19:40 94  
[   ]org.ligi.satoshiproof.json2023-05-23 12:25 94  
[   ]org.sasehash.burgerwp.json2023-06-02 07:13 94  
[   ]org.segin.bfinterpreter.json2023-05-22 16:53 94  
[   ]org.sixgun.ponyexpress.json2023-05-22 16:15 94  
[   ]org.tamanegi.atmosphere.json2023-05-22 12:40 94  
[   ]org.tvheadend.tvhguide.json2023-05-22 09:06 94  
[   ]org.wikilovesmonuments.json2023-05-22 07:19 94  
[   ]org.witness.sscphase1.json2023-05-22 07:03 94  
[   ]org.wordpress.android.json2023-05-22 06:30 94  
[   ]pl.ascendit.onetimealarm.json2023-05-22 05:11 94  
[   ]pro.oneredpixel.l9droid.json2023-05-22 03:23 94  
[   ]protect.gift_card_guard.json2023-05-22 03:08 94  
[   ]sony.hidden.servicemenu.json2023-06-03 06:47 94  
[   ]tf.nox.wifisetup.json2023-06-03 06:40 94  
[   ]z4pp3r.flashlightwidget.json2023-06-03 06:27 94  
[   ]am.ed.exportcontacts.json2023-04-29 01:51 95  
[   ]at.zweng.bankomatinfos2.json2023-04-06 18:51 95  
[   ]au.com.darkside.XServer.json2023-04-28 23:32 95  
[   ]be.humanoids.webthingify.json2023-04-28 23:24 95  
[   ]biz.codefuture.svgviewer.json2023-04-06 18:24 95  
[   ]br.com.dgimenes.nasapic.json2023-04-28 23:05 95  
[   ]co.epitre.aelf_lectures.json2023-05-27 10:20 95  
[   ]com.akshayaap.mouseremote.json2023-06-05 11:24 95  
[   ]com.alexcruz.papuhwalls.json2023-04-28 20:23 95  
[   ]com.blntsoft.emailpopup.json2023-06-05 11:06 95  
[   ]com.bmpak.anagramsolver.json2023-06-05 11:06 95  
[   ]com.brapeba.roaminginfo.json2023-06-05 10:56 95  
[   ]com.brucelet.spacetrader.json2023-06-20 14:18 95  
[   ]com.carriez.flutter_hbb.json2023-06-05 09:28 95  
[   ]com.chesire.nekome.json2023-06-08 12:00 95  
[   ]com.claha.showtimeremote.json2023-06-05 09:20 95  
[   ]com.cradle.iitc_mobile.json2023-06-05 09:13 95  
[   ]com.dconstructing.cooper.json2023-04-28 05:12 95  
[   ]com.elementlo.spark_list.json2023-06-05 08:53 95  
[   ]com.emmanuelmess.itsdicey.json2023-04-28 02:03 95  
[   ]com.florianthaler.githo.json2023-04-28 00:07 95  
[   ]com.fproject.cryptolitycs.json2023-04-27 22:19 95  
[   ]com.gimranov.zandy.app.json2023-04-27 20:32 95  
[   ]com.gitea.theoden8.sudaku.json2023-04-27 20:03 95  
[   ]com.goltzkiste.guessaday.json2023-04-27 15:30 95  
[   ]com.googlecode.gtalksms.json2023-04-27 15:25 95  
[   ]com.hearham.repeaterstart.json2021-03-13 12:46 95  
[   ]com.joshtwigg.cmus.droid.json2023-04-27 08:58 95  
[   ]com.kn.paper_foss_theme.json2023-04-27 07:46 95  
[   ]com.mirfatif.noorulhuda.json2023-04-27 01:40 95  
[   ]com.msapps.touchdetector.json2023-04-27 00:41 95  
[   ]com.namelessdev.mpdroid.json2023-04-27 00:26 95  
[   ]com.nima.guessthatpokemon.json2023-05-06 09:17 95  
[   ]com.niparasc.papanikolis.json2023-04-26 20:52 95  
[   ]com.quaap.dodatheexploda.json2023-04-26 13:23 95  
[   ]com.redblaster.hsl.main.json2023-04-26 12:38 95  
[   ]com.roozbehzarei.filester.json2023-05-23 23:00 95  
[   ]com.rouzbehzarei.filester.json2023-05-27 08:37 95  
[   ]com.rubenroy.minimaltodo.json2023-04-26 12:01 95  
[   ]com.samarthdesai.repeatme.json2023-04-26 11:43 95  
[   ]com.smorgasbork.hotdeath.json2023-04-26 07:55 95  
[   ]com.tobykurien.batteryfu.json2023-04-26 03:25 95  
[   ]com.tomer.poke.notifier.json2023-04-26 02:32 95  
[   ]com.traffar.game_of_life.json2023-04-26 02:22 95  
[   ]com.vuze.android.remote.json2023-04-25 22:38 95  
[   ]com.wbrenna.gtfsoffline.json2023-04-25 22:00 95  
[   ]com.weskenyon.bookmarkos.json2023-04-25 21:57 95  
[   ]com.xenris.liquidwarsos.json2023-04-25 21:23 95  
[   ]com.zegoggles.smssync.json2021-03-08 20:19 95  
[   ]de.mathfactory.mooltifill.json2023-05-20 01:20 95  
[   ]de.onyxbits.pocketbandit.json2023-05-20 00:02 95  
[   ]de.piratentools.spickerrr.json2023-05-19 23:51 95  
[   ]de.rochefort.childmonitor.json2023-07-12 07:31 95  
[   ]dev.jmoore.lametricnotify.json2023-05-19 19:42 95  
[   ]dev.obfusk.jiten.json2023-05-21 08:13 95  
[   ]dev.ukanth.ufirewall.json2023-05-19 19:20 95  
[   ]dk.meznik.jan.encrypttext.json2023-05-19 17:55 95  
[   ]eu.veldsoft.free.klondike.json2023-05-19 14:31 95  
[   ]in.umairkhan.remotedroid.json2023-05-19 02:16 95  
[   ]io.github.baiatbun.react.json2023-05-19 02:05 95  
[   ]jp.sfjp.webglmol.NDKmol.json2023-05-18 12:19 95  
[   ]lanchon.sigspoof.checker.json2023-05-18 10:13 95  
[   ]me.austinhuang.caweather.json2023-06-05 07:58 95  
[   ]me.tagavari.airmessage.json2023-07-17 05:43 95  
[   ]net.micode.soundrecorder.json2023-06-04 21:46 95  
[   ]net.osmand.parkingPlugin.json2023-03-31 14:48 95  
[   ]net.redsolver.noteless.json2023-06-04 13:26 95  
[   ]org.androidsoft.coloring.json2023-07-04 07:12 95  
[   ]org.calyxinstitute.vpn.json2023-06-03 06:26 95  
[   ]org.ddosolitary.okcagent.json2023-05-15 19:08 95  
[   ]org.fossasia.openevent.json2023-05-23 20:00 95  
[   ]org.jamienicol.episodes.json2023-05-23 15:23 95  
[   ]org.openttd.fdroid.json2023-06-03 08:05 95  
[   ]org.quovadit.apps.andof.json2023-05-23 00:24 95  
[   ]org.redcross.openmapkit.json2023-05-28 06:39 95  
[   ]org.schabi.terminightor.json2023-05-22 17:43 95  
[   ]org.smblott.intentradio.json2023-05-22 16:12 95  
[   ]org.sparkleshare.android.json2023-05-22 15:56 95  
[   ]org.whitequark.sipcaller.json2023-05-22 07:19 95  
[   ]rino.org.tethercompanion.json2023-05-22 03:01 95  
[   ]ro.hume.cosmin.retrostack.json2023-05-22 02:41 95  
[   ]ru.neverdark.silentnight.json2023-05-22 01:28 95  
[   ]space.neothefox.laytray.json2023-06-03 06:47 95  
[   ]tk.giesecke.painlessmesh.json2023-05-21 20:13 95  
[   ]tw.qtlin.mac.airunlocker.json2023-05-21 19:23 95  
[   ]akk.astro.droid.moonphase.json2023-04-29 01:51 96  
[   ]app.tice.TICE.production.json2023-04-29 01:11 96  
[   ]byrne.utilities.converter.json2023-04-28 23:00 96  
[   ]com.FireFart.Permissions2.json2023-06-10 10:41 96  
[   ]com.aliernfrog.LacMapTool.json2023-06-05 11:24 96  
[   ]com.altillimity.satpredict.json2023-06-10 11:16 96  
[   ]com.android2.calculator3.json2023-06-05 11:22 96  
[   ]com.artivain.reseaudiscord.json2023-06-04 00:25 96  
[   ]com.berdik.letmedowngrade.json2023-06-03 20:57 96  
[   ]com.bri1.soundbored.reborn.json2023-06-05 10:09 96  
[   ]com.commonslab.commonslab.json2023-06-03 15:56 96  
[   ]com.dfzlv.gjjlt.caramelos.json2023-06-05 09:06 96  
[   ]com.ecuamobi.deckwallet.json2023-06-05 08:53 96  
[   ]com.emmanuelmess.tictactoe.json2023-06-03 11:47 96  
[   ]com.example.booklistingapk.json2023-04-28 00:54 96  
[   ]com.frrahat.quransimple.json2023-04-27 22:05 96  
[   ]com.ghostsq.commander.smb.json2023-01-09 19:07 96  
[   ]com.github.dawidd6.andttt.json2023-04-27 18:12 96  
[   ]com.github.egonw.isotopes.json2023-04-27 18:01 96  
[   ]com.github.xloem.qrstream.json2023-04-27 15:57 96  
[   ]com.googlecode.gogodroid.json2023-04-27 15:12 96  
[   ]com.icechen1.notable.pro.json2023-04-27 13:19 96  
[   ]com.invano.ambientweather.json2023-04-27 12:15 96  
[   ]com.jeffliu.balancetheball.json2023-04-27 10:12 96  
[   ]com.jim.sharetocomputer.json2023-04-27 09:39 96  
[   ]com.jotabout.screeninfo.json2023-04-27 08:46 96  
[   ]com.kokkle.gamevirusattack.json2023-04-27 07:44 96  
[   ]com.miqote.angelplayerwp.json2023-04-27 01:45 96  
[   ]com.mishiranu.dashchan.json2023-04-27 01:41 96  
[   ]com.mobile.bummerzaehler.json2023-04-27 01:23 96  
[   ]com.mobilepearls.sokoban.json2023-04-27 01:23 96  
[   ]com.morlunk.mumbleclient.json2023-04-27 00:59 96  
[   ]com.neumorphic.calculator.json2023-04-27 00:03 96  
[   ]com.nickspatties.timeclock.json2023-06-03 10:53 96  
[   ]com.simplecity.amp_pro.json2021-03-13 14:40 96  
[   ]com.tastycactus.timesheet.json2023-04-26 04:15 96  
[   ]com.tombursch.kitchenowl.json2023-05-06 09:07 96  
[   ]com.tttdevs.stncbookmarks.json2023-04-26 02:16 96  
[   ]com.tunjid.fingergestures.json2021-03-09 01:23 96  
[   ]com.unwind.networkmonitor.json2023-04-25 23:17 96  
[   ]com.watabou.pixeldungeon.json2023-04-25 22:18 96  
[   ]com.workingagenda.fissure.json2023-04-25 21:47 96  
[   ]community.fairphone.clock.json2023-04-27 00:33 96  
[   ]cx.mccormick.pddroidparty.json2023-05-11 23:45 96  
[   ]cz.eutopia.snooperstopper.json2023-05-11 22:40 96  
[   ]cz.vitSkalicky.klavesnice.json2023-05-11 22:17 96  
[   ]de.beowulf.libretranslater.json2023-05-20 07:39 96  
[   ]de.jugendhacker.xmppadmin.json2023-05-20 02:33 96  
[   ]de.measite.contactmerger.json2023-05-20 01:25 96  
[   ]de.onyxbits.photobookmark.json2023-07-12 07:35 96  
[   ]de.onyxbits.sensorreadout.json2023-05-19 23:58 96  
[   ]de.skubware.opentraining.json2023-05-19 23:02 96  
[   ]dev.danjackson.noisecancel.json2023-06-05 08:13 96  
[   ]dk.andsen.asqlitemanager.json2023-05-19 18:10 96  
[   ]edu.cmu.pocketsphinx.demo.json2023-05-19 17:13 96  
[   ]edu.killerud.kitchentimer.json2023-05-19 17:07 96  
[   ]eu.veldsoft.house.of.cards.json2023-05-19 14:31 96  
[   ]fi.bitrite.android.ws.json2023-05-19 14:16 96  
[   ]fr.ybo.transportsrennes.json2023-05-19 07:15 96  
[   ]groomiac.voicemailplayer.json2023-07-17 06:10 96  
[   ]info.puzz.a10000sentences.json2023-05-19 02:32 96  
[   ]io.github.engsergiu.react.json2023-05-19 01:17 96  
[   ]io.github.randomfilemaker.json2023-05-18 23:20 96  
[   ]me.anuraag.loveactualized.json2023-05-18 01:23 96  
[   ]name.soulayrol.rhaa.sholi.json2023-06-05 04:14 96  
[   ]net.etuldan.sparss.floss.json2023-06-04 23:04 96  
[   ]net.kervala.comicsreader.json2023-07-04 07:44 96  
[   ]net.stargw.contactsimport.json2023-05-23 22:30 96  
[   ]net.syntaxblitz.plucklock.json2023-06-04 12:12 96  
[   ]np.com.binabh.basedcooking.json2023-05-16 23:46 96  
[   ]onlymash.flexbooru.play.json2023-06-04 10:04 96  
[   ]org.katsarov.heatcalc.json2023-05-28 21:33 96  
[   ]org.legtux.m_316k.fortune.json2023-05-28 19:44 96  
[   ]org.moparisthebest.appbak.json2023-05-28 15:22 96  
[   ]org.ndeftools.boilerplate.json2023-05-28 13:16 96  
[   ]org.savapage.android.print.json2023-05-22 18:04 96  
[   ]org.studip.unofficial_app.json2023-05-22 13:37 96  
[   ]org.yuttadhammo.tipitaka.json2023-05-22 05:48 96  
[   ]priv.wh201906.serialtest.json2023-05-22 03:25 96  
[   ]pro.rudloff.muzei.commons.json2023-05-22 03:21 96  
[   ]ru.glesik.nostrangersms.json2023-05-22 01:40 96  
[   ]ru.ifproject.android.afr.json2023-05-22 01:33 96  
[   ]saschpe.contactevents.json2023-05-22 00:39 96  
[   ]systems.byteswap.aiproute.json2023-06-03 06:44 96  
[   ]uk.ac.swansea.eduroamcat.json2023-05-21 19:04 96  
[   ]ymakei.vegetarian_journal.json2023-06-01 11:50 96  
[   ]be.uhasselt.privacypolice.json2023-04-28 23:20 97  
[   ]com.Sommerlichter.social.json2023-04-26 07:55 97  
[   ]com.abhinavmarwaha.curator.json2023-04-28 20:41 97  
[   ]com.amabyte.vtucslabmanual.json2023-04-28 20:00 97  
[   ]com.boztalay.puppyframeuid.json2023-04-28 11:49 97  
[   ]com.dimension.tessercube.json2023-06-05 09:06 97  
[   ]com.dirkgassen.wator.json2023-04-28 04:46 97  
[   ]com.dragons.aurora.json2023-04-28 03:32 97  
[   ]com.google.android.gms.json2023-04-27 15:29 97  
[   ]com.google.code.apps2org.json2023-04-27 15:17 97  
[   ]com.halftough.webcomreader.json2023-04-27 14:12 97  
[   ]com.iamtrk.androidexplorer.json2023-04-27 13:21 97  
[   ]com.isanexusdev.androidcpg.json2023-04-27 10:37 97  
[   ]com.leestarb.fourthtools.json2023-06-03 10:57 97  
[   ]com.mantz_it.rfanalyzer.json2023-04-27 03:26 97  
[   ]com.murrayc.galaxyzoo.app.json2023-04-27 00:29 97  
[   ]com.nathanosman.chronosnap.json2023-04-27 00:07 97  
[   ]com.nephi.getoffyourphone.json2023-04-26 23:58 97  
[   ]com.nishantboro.splititeasy.json2023-04-26 20:47 97  
[   ]com.nitish.privacyindicator.json2023-04-26 20:47 97  
[   ]com.omegavesko.holocounter.json2023-04-26 17:37 97  
[   ]com.omegavesko.sutransplus.json2023-04-26 17:36 97  
[   ]com.openpi.spellingwizard.json2023-04-26 17:31 97  
[   ]com.pavelsof.wormhole.json2023-04-26 16:08 97  
[   ]com.pluscubed.matloglibre.json2023-04-26 14:32 97  
[   ]com.sandeel.bushidoblocks.json2023-04-26 11:31 97  
[   ]com.sensirion.smartgadget.json2023-04-26 10:37 97  
[   ]com.simplytranslate_mobile.json2023-04-26 08:50 97  
[   ]com.thechiefmeat.freetusky.json2023-04-26 03:56 97  
[   ]com.tomaszmarzeion.notepad.json2023-04-26 03:12 97  
[   ]com.trianguloy.adnihilation.json2023-06-03 10:44 97  
[   ]com.twistedplane.sealnote.json2023-04-26 00:18 97  
[   ]com.zachrattner.pockettalk.json2023-04-25 21:05 97  
[   ]covidsecure.uk.venuecheckin.json2023-05-12 05:08 97  
[   ]de.digisocken.stop_o_moto.json2023-05-20 04:14 97  
[   ]de.grobox.appbundlereporter.json2023-05-20 03:20 97  
[   ]de.k3b.android.camerafolder.json2023-05-20 02:20 97  
[   ]de.onyxbits.remotekeyboard.json2023-05-19 23:59 97  
[   ]de.sirjofri.fingerlist.json2023-05-19 22:56 97  
[   ]de.spiritcroc.riotx.json2021-03-13 16:29 97  
[   ]digital.selfdefense.lucia.json2023-05-19 18:08 97  
[   ]fi.harism.wallpaper.flier.json2023-05-19 14:13 97  
[   ]info.aario.mywifipasswords.json2023-05-19 03:21 97  
[   ]it.angrydroids.epub3reader.json2023-05-18 16:31 97  
[   ]jonas.tool.saveForOffline.json2023-05-18 13:15 97  
[   ]mkg20001.net.samremote.json2023-06-24 10:33 97  
[   ]name.myigel.fahrplan.eh17.json2023-06-05 04:17 97  
[   ]net.alegen.android.netclip.json2023-05-17 15:00 97  
[   ]net.basov.lws.qr.fdroid.json2023-05-17 14:53 97  
[   ]net.somethingdreadful.MAL.json2023-06-04 12:52 97  
[   ]one.librem.social.multi.json2023-05-16 23:26 97  
[   ]org.avmedia.remotevideocam.json2023-06-04 07:56 97  
[   ]org.chickenhook.binderfuzzy.json2023-05-15 20:37 97  
[   ]org.emergent.android.weave.json2023-05-29 02:56 97  
[   ]org.jfo.app.makesomenoise.json2023-05-28 21:34 97  
[   ]org.nexttracks.android.json2023-02-16 02:42 97  
[   ]org.passwordmaker.android.json2023-05-28 07:45 97  
[   ]org.safermobile.intheclear.json2023-05-14 20:07 97  
[   ]org.sge.haltestellenanzeige.json2023-05-22 16:32 97  
[   ]org.vi_server.androidudpbus.json2023-06-03 06:57 97  
[   ]ru.gelin.android.sendtosd.json2023-05-22 02:09 97  
[   ]ru.nsu.bobrofon.easysshfs.json2023-05-22 01:30 97  
[   ]screen.dimmer.pixelfilter.json2023-06-03 06:52 97  
[   ]se.tube42.kidsmem.android.json2023-05-22 00:09 97  
[   ]tk.giesecke.disaster_radio.json2023-05-21 20:13 97  
[   ]yellr.net.yellr_android.json2023-05-21 12:47 97  
[   ]be.brunoparmentier.apkshare.json2023-04-28 23:28 98  
[   ]br.com.frs.foodrestrictions.json2023-04-28 23:04 98  
[   ]ch.thgoebel.spartathlonapp.json2023-05-24 08:46 98  
[   ]click.dummer.have_radiosion.json2023-04-28 21:13 98  
[   ]com.achep.widget.jellyclock.json2023-06-05 11:26 98  
[   ]com.autismprime.krassesSpiel.json2023-06-05 11:15 98  
[   ]com.bmco.cratesiounofficial.json2023-04-28 12:15 98  
[   ]com.chanapps.four.activity.json2023-06-05 09:21 98  
[   ]com.cityfreqs.littlesirecho.json2023-06-03 16:28 98  
[   ]com.corvettecole.gotosleep.json2023-06-03 15:53 98  
[   ]com.danielkim.soundrecorder.json2023-06-03 14:43 98  
[   ]com.derek_s.hubble_gallery.json2023-06-05 09:06 98  
[   ]com.dimowner.audiorecorder.json2023-04-28 04:46 98  
[   ]com.dozingcatsoftware.dodge.json2023-06-03 13:10 98  
[   ]com.evancharlton.mileage.json2023-04-28 01:06 98  
[   ]com.evenement.encapsulation.json2023-04-28 01:01 98  
[   ]com.falconware.prestissimo.json2023-04-28 00:26 98  
[   ]com.germainz.identiconizer.json2023-04-27 20:57 98  
[   ]com.ghostsq.commander.samba.json2023-01-09 19:07 98  
[   ]com.github.grimpy.botifier.json2023-04-27 17:53 98  
[   ]com.github.mofosyne.tagdrop.json2023-06-03 11:10 98  
[   ]com.github.onetimepass.json2023-06-02 01:58 98  
[   ]com.github.sryze.wirebug.json2023-06-03 11:05 98  
[   ]com.github.wakhub.tinyclock.json2023-06-03 11:05 98  
[   ]com.github.webierta.carfoin.json2023-07-10 15:27 98  
[   ]com.igormaznitsa.piratedice.json2023-04-27 13:12 98  
[   ]com.innodroid.mongobrowser.json2023-04-27 12:17 98  
[   ]com.kidozh.discuzhub.fdroid.json2023-06-03 10:57 98  
[   ]com.majeur.applicationsinfo.json2023-04-27 03:40 98  
[   ]com.mattgmg.miracastwidget.json2023-04-27 02:52 98  
[   ]com.mod.android.widget.fbcw.json2023-04-27 01:13 98  
[   ]com.nolanlawson.apptracker.json2023-04-26 20:17 98  
[   ]com.nolanlawson.chordreader.json2023-04-26 20:05 98  
[   ]com.notriddle.null_launcer.json2023-04-26 18:59 98  
[   ]com.pdb82.flashlighttiramisu.json2023-04-26 16:03 98  
[   ]com.rastating.droidbeard.json2023-04-26 12:42 98  
[   ]com.saverio.wordoftheday_en.json2023-04-26 11:18 98  
[   ]com.suyashsrijan.forcedoze.json2023-04-26 05:00 98  
[   ]com.trianguloy.isUserAMonkey.json2023-05-20 07:57 98  
[   ]com.ultrafunk.network_info.json2023-04-26 00:10 98  
[   ]com.wesaphzt.privatelocation.json2023-04-25 21:56 98  
[   ]daniel_32.flexiblewallpaper.json2023-05-11 20:15 98  
[   ]de.b0nk.fp1_epo_autoupdate.json2023-05-11 20:06 98  
[   ]de.boesling.hydromemo.json2023-05-20 06:48 98  
[   ]de.hu_berlin.eduroam.json2023-05-20 03:01 98  
[   ]de.idiomreplacex.browser_app.json2023-06-03 10:36 98  
[   ]de.j4velin.systemappmover.json2023-05-20 03:01 98  
[   ]de.lukaspieper.gcam.services.json2023-05-20 01:39 98  
[   ]de.phoenixstudios.pc_dimmer.json2023-05-19 23:53 98  
[   ]de.shandschuh.slightbackup.json2023-07-15 07:31 98  
[   ]edu.cmu.cs.speech.tts.flite.json2022-02-05 22:02 98  
[   ]eu.veldsoft.colors.overflow.json2023-05-19 14:36 98  
[   ]eu.veldsoft.tuty.fruty.slot.json2023-05-19 14:30 98  
[   ]eu.wikijourney.wikijourney.json2023-05-19 14:28 98  
[   ]fi.harism.wallpaper.yinyang.json2023-05-19 14:11 98  
[   ]fr.ybo.transportsbordeaux.json2023-05-19 07:15 98  
[   ]free.rm.skytube.legacy.oss.json2023-05-19 13:38 98  
[   ]im.r_c.android.clearweather.json2023-05-19 04:50 98  
[   ]info.guardianproject.cacert.json2023-05-19 03:08 98  
[   ]info.guardianproject.gilga.json2023-05-19 03:06 98  
[   ]io.github.sanbeg.flashlight.json2023-05-18 23:20 98  
[   ]io.githubfede0d.planetrider.json2023-05-19 01:22 98  
[   ]me.konyaco.collinsdictionary.json2023-05-17 23:59 98  
[   ]name.bagi.levente.pedometer.json2023-05-17 20:45 98  
[   ]net.bitconomy.ckpoolwatcher.json2023-05-17 14:06 98  
[   ]net.khertan.forrunners.json2023-06-04 22:07 98  
[   ]net.schueller.instarepost.json2023-06-04 13:20 98  
[   ]nl.patrickkostjens.kandroid.json2023-05-16 23:55 98  
[   ]org.androidpn.client.json2023-06-04 09:10 98  
[   ]org.developfreedom.logmein.json2023-05-15 18:44 98  
[   ]org.dynamicsoft.caloriescope.json2023-05-29 03:09 98  
[   ]org.eukalyptus.liquidrechner.json2023-05-29 02:37 98  
[   ]org.flyve.mdm.agent.mqtt.json2023-05-29 02:09 98  
[   ]org.gege.caldavsyncadapter.json2023-05-23 18:27 98  
[   ]org.jfedor.nxtremotecontrol.json2023-05-28 21:37 98  
[   ]org.openintents.notepad.json2023-05-23 04:51 98  
[   ]org.schabi.sharewithnewpipe.json2023-05-22 17:43 98  
[   ]org.zephyrsoft.checknetwork.json2023-05-22 05:38 98  
[   ]pt.joaomneto.titancompanion.json2023-05-22 03:06 98  
[   ]sk.madzik.android.logcatudp.json2023-05-21 21:57 98  
[   ]uk.ac.ed.inf.mandelbrotmaps.json2023-06-03 06:37 98  
[   ]uscartools.USTravelConverter.json2023-06-01 18:13 98  
[   ]zen.meditation.android.json2023-05-21 12:36 98  
[   ]aws.apps.usbDeviceEnumerator.json2023-04-28 23:29 99  
[   ]be.brunoparmentier.dnssetter.json2023-04-28 23:28 99  
[   ]ca.farrelltonsolar.classic.json2023-04-28 22:42 99  
[   ]ch.jiikuy.velocitycalculator.json2023-05-25 14:19 99  
[   ]click.dummer.funphonepuppet.json2023-05-27 10:22 99  
[   ]com.Bisha.TI89EmuDonation.json2023-05-24 00:08 99  
[   ]com.aidinhut.simpletextcrypt.json2023-04-28 20:25 99  
[   ]com.albertobonacina.wassword.json2023-06-04 02:00 99  
[   ]com.catalin.css_px_converter.json2023-05-12 06:18 99  
[   ]com.danielme.muspyforandroid.json2023-06-05 09:09 99  
[   ]com.digitalfishfun.openshift.json2023-04-28 04:48 99  
[   ]com.example.harisont.librery.json2023-04-28 00:51 99  
[   ]com.frozendevs.periodictable.json2023-04-27 22:05 99  
[   ]com.garyodernichts.downgrader.json2023-04-27 21:46 99  
[   ]com.github.funkyg.funkytunes.json2023-04-27 17:58 99  
[   ]com.github.pires.obd.reader.json2023-04-27 16:49 99  
[   ]com.gmail.cn.leetao94.rssaid.json2023-04-27 15:38 99  
[   ]com.gmail.mugcuposup.android.json2023-04-27 15:33 99  
[   ]com.gonnaggstudio.oh_tai_gi.json2023-05-27 08:57 99  
[   ]com.infonuascape.osrshelper.json2023-04-27 12:19 99  
[   ]com.kanedias.archforums.json2023-04-27 08:18 99  
[   ]com.mendhak.conscryptprovider.json2023-07-15 08:13 99  
[   ]com.rafapps.earthviewformuzei.json2023-05-06 09:14 99  
[   ]com.saladdressing.veterondo.json2023-04-26 11:47 99  
[   ]com.scar45.aokp.co.webviewer.json2023-04-26 11:18 99  
[   ]com.theworld.help.cbtandroid.json2023-04-26 03:52 99  
[   ]com.urbandroid.dontkillmyapp.json2023-04-25 23:15 99  
[   ]com.xabber.android.classic.json2023-04-25 21:46 99  
[   ]de.bashtian.dashclocksunrise.json2023-05-11 19:33 99  
[   ]de.telefongarten.brainjogging.json2023-07-15 07:26 99  
[   ]de.uwepost.android.deltacam.json2023-05-19 20:07 99  
[   ]de.yazo_games.mensaguthaben.json2023-05-19 18:08 99  
[   ]dev.obfusk.sokobang.json2023-05-21 08:15 99  
[   ]eu.veldsoft.vitosha.blackjack.json2023-05-19 14:28 99  
[   ]fi.harism.wallpaper.flowers.json2023-05-19 14:11 99  
[   ]info.zwanenburg.caffeinetile.json2023-05-27 08:01 99  
[   ]io.github.danxi_dev.dan_xi.json2023-05-19 01:48 99  
[   ]io.github.easyintent.quickref.json2023-05-19 01:16 99  
[   ]it.andreascarpino.hostisdown.json2023-05-18 16:30 99  
[   ]it.lucci.cm.greyscaletheme.json2023-05-18 15:39 99  
[   ]it.rignanese.leo.slimtwitter.json2023-05-18 13:29 99  
[   ]jp.gr.java_conf.hatalab.mnv.json2023-05-18 12:28 99  
[   ]me.alexghr.android.bulkshare.json2023-05-18 01:26 99  
[   ]nerd.tuxmobil.fahrplan.camp.json2023-06-05 03:50 99  
[   ]net.mafro.android.wakeonlan.json2023-06-04 21:17 99  
[   ]net.sf.andbatdog.batterydog.json2023-06-04 12:53 99  
[   ]net.sf.andhsli.hotspotlogin.json2023-06-04 12:53 99  
[   ]news.androidtv.launchonboot.json2023-05-17 00:05 99  
[   ]org.androidappdev.wifiwidget.json2023-06-04 09:17 99  
[   ]org.cprados.wificellmanager.json2023-05-15 19:14 99  
[   ]org.glpi.inventory.agent.json2023-06-03 08:29 99  
[   ]org.handmadeideas.chordreader.json2023-05-23 16:45 99  
[   ]org.kde.necessitas.ministro.json2023-05-23 13:57 99  
[   ]org.mupen64plusae.v3.alpha.json2023-05-28 13:21 99  
[   ]org.owntracks.android.json2023-06-03 07:40 99  
[   ]org.purple.smokestack.json2023-05-28 06:40 99  
[   ]org.schabi.openhitboxstreams.json2023-05-22 17:43 99  
[   ]org.strawberryforum.pollywog.json2023-05-22 13:38 99  
[   ]org.surrel.messengerbypasser.json2023-05-22 12:58 99  
[   ]org.torproject.torservices.json2023-06-03 06:58 99  
[   ]org.wheelmap.android.online.json2023-05-22 07:30 99  
[   ]pc.javier.actualizadoropendns.json2023-05-22 05:13 99  
[   ]pl.narfsoftware.thermometer.json2023-05-22 03:43 99  
[   ]pro.rudloff.search_to_browser.json2023-05-22 03:19 99  
[   ]ru.tech.imageresizershrinker.json2023-06-02 07:02 99  
[   ]se.danielj.geometridestroyer.json2023-05-22 00:37 99  
[   ]se.erikofsweden.findmyphone.json2023-05-22 00:33 99  
[   ]tw.com.daxia.virtualsoftkeys.json2023-05-21 19:20 99  
[   ]us.achromaticmetaphor.agram.json2023-06-02 06:35 99  
[   ]com.alaskalinuxuser.hourglass.json2023-06-05 11:24 100  
[   ]com.alaskalinuxuser.justnotes.json2023-06-05 11:24 100  
[   ]com.alienpants.leafpicrevived.json2023-06-05 11:24 100  
[   ]com.brosmike.airpushdetector.json2023-06-24 12:37 100  
[   ]com.einmalfel.podlisten.json2023-06-05 08:52 100  
[   ]com.eleybourn.bookcatalogue.json2023-04-28 02:57 100  
[   ]com.frozendevs.cache.cleaner.json2023-04-27 22:04 100  
[   ]com.github.kiliakin.yalpstore.json2023-04-27 17:33 100  
[   ]com.github.vatbub.scoreboard.json2023-06-03 11:05 100  
[   ]com.github.yeriomin.workoutlog.json2023-04-27 15:43 100  
[   ]com.github.ympavlov.minidoro.json2023-04-27 15:42 100  
[   ]com.gunshippenguin.openflood.json2023-04-27 14:40 100  
[   ]com.harasoft.relaunch.json2023-04-27 14:39 100  
[   ]com.hectorone.multismssender.json2023-04-27 13:35 100  
[   ]com.htruong.inputmethod.latin.json2023-04-27 13:33 100  
[   ]com.iboalali.sysnotifsnooze.json2023-04-27 13:20 100  
[   ]com.jarsilio.android.pocketup.json2023-04-27 10:23 100  
[   ]com.kanedias.vanilla.metadata.json2023-04-27 08:06 100  
[   ]com.khuttun.notificationnotes.json2023-04-27 07:52 100  
[   ]com.leafdigital.kanji.android.json2023-04-27 06:30 100  
[   ]com.mustafaali.sensorssandbox.json2023-04-27 00:30 100  
[   ]com.mystro256.autooffbluetooth.json2023-04-27 00:24 100  
[   ]com.namsor.api.samples.gendre.json2023-04-27 00:24 100  
[   ]com.nesswit.galbijjimsearcher.json2023-04-27 00:06 100  
[   ]com.npes87184.s2tdroid.donate.json2023-04-26 18:57 100  
[   ]com.orpheusdroid.sqliteviewer.json2023-04-26 17:09 100  
[   ]com.rascarlo.power.button.tile.json2023-04-26 12:42 100  
[   ]com.roguetemple.hyperroid.json2023-12-15 05:22 100  
[   ]com.saiga.find.messagefinder.json2023-04-26 11:45 100  
[   ]com.samsandberg.mtafarebuster.json2023-04-26 11:28 100  
[   ]de.k3b.android.geo2articlesmap.json2023-05-20 02:20 100  
[   ]de.ktran.anno1404warenrechner.json2023-05-20 01:52 100  
[   ]edu.harvard.android.mmskeeper.json2023-05-19 17:14 100  
[   ]eu.lighthouselabs.obd.reader.json2023-05-19 15:43 100  
[   ]eu.veldsoft.vitosha.poker.odds.json2023-05-19 14:28 100  
[   ]info.staticfree.SuperGenPass.json2023-05-19 02:32 100  
[   ]io.github.muntashirakon.unapkm.json2023-05-18 23:20 100  
[   ]io.gitlab.danielrparks.vibrato.json2023-05-18 21:57 100  
[   ]io.nandandesai.privacybreacher.json2023-05-18 18:11 100  
[   ]jupiter.broadcasting.live.tv.json2023-05-18 12:12 100  
[   ]krasilnikov.alexey.cryptopass.json2023-05-18 11:52 100  
[   ]mbmb5.lumixextendedcontrolapp.json2023-05-18 01:44 100  
[   ]net.logomancy.dashquotes.civ5.json2023-06-04 21:48 100  
[   ]net.usikkert.kouchat.android.json2023-05-17 00:24 100  
[   ]org.androidsoft.games.slowit.json2023-06-04 09:07 100  
[   ]org.covolunablu.marswallpaper.json2023-05-15 19:14 100  
[   ]org.cyanogenmod.great.freedom.json2023-05-15 19:10 100  
[   ]org.kaziprst.android.ndfilter.json2023-05-28 21:32 100  
[   ]org.proninyaroslav.libretrack.json2023-05-23 01:31 100  
[   ]org.quicksc0p3r.simplecounter.json2023-12-12 07:47 100  
[   ]org.secuso.privacyfriendlypin.json2023-05-22 17:15 100  
[   ]org.toulibre.capitoledulibre.json2023-05-22 09:43 100  
[   ]se.bitcraze.crazyfliecontrol2.json2023-05-22 00:32 100  
[   ]ca.littlesvr.everyonestimetable.json2023-04-28 22:41 101  
[   ]com.allansimon.verbisteandroid.json2023-06-10 11:16 101  
[   ]com.beckhamd.nasaimageryfetcher.json2021-04-02 08:54 101  
[   ]com.briankhuu.nfcmessageboard.json2023-04-28 10:51 101  
[   ]com.bytesforge.linkasanote.json2023-06-05 10:02 101  
[   ]com.crazyhitty.chdev.ks.munch.json2023-04-28 07:04 101  
[   ]com.emacberry.uuid0xfd6fscan.json2023-04-28 02:04 101  
[   ]com.emmanuelmess.simplecleanup.json2023-06-03 11:48 101  
[   ]com.fredhappyface.brainf.json2023-04-27 22:11 101  
[   ]com.fredhappyface.fhcode.json2023-04-27 22:11 101  
[   ]com.github.cvzi.wallpaperexport.json2023-04-27 18:17 101  
[   ]com.github.darthjoey91.hangman.json2023-04-27 18:13 101  
[   ]com.gitlab.giwiniswut.rwremount.json2023-04-27 15:40 101  
[   ]com.hayaisoftware.launcher.json2023-04-27 13:54 101  
[   ]com.littlebytesofpi.pylauncher.json2023-07-10 10:35 101  
[   ]com.maxfierke.sandwichroulette.json2023-04-27 02:51 101  
[   ]com.nolanlawson.jnameconverter.json2023-04-26 20:05 101  
[   ]com.nomadlabs.labcoat.deeplinks.json2023-04-26 19:59 101  
[   ]com.primavera.arduino.listener.json2023-04-26 13:28 101  
[   ]com.procrastimax.birthdaybuddy.json2023-04-26 13:28 101  
[   ]com.ridgelineapps.resdicegame.json2023-04-26 12:12 101  
[   ]com.stealthcotper.networktools.json2023-04-26 05:13 101  
[   ]com.tistory.deque.previewmaker.json2023-04-26 03:48 101  
[   ]com.xatik.app.droiddraw.client.json2023-04-25 21:29 101  
[   ]com.zoffcc.applications.aagtl.json2023-04-25 20:51 101  
[   ]com.zoffcc.fahrplan.toxcon.json2023-05-12 05:35 101  
[   ]de.beatbrot.screenshotassistant.json2023-05-20 07:43 101  
[   ]de.binary_kitchen.doorlock_app.json2023-05-20 07:29 101  
[   ]de.perflyst.batterycalibration.json2023-07-15 07:36 101  
[   ]de.taz.android.app.free.json2023-05-19 21:43 101  
[   ]de.wikilab.android.friendica01.json2023-05-19 18:41 101  
[   ]fr.simon.marquis.secretcodes.json2023-05-19 07:41 101  
[   ]github.vatsal.easyweatherdemo.json2023-05-19 06:54 101  
[   ]io.github.powerinside.syncplay.json2023-05-18 23:21 101  
[   ]io.github.subhamtyagi.nightmode.json2023-05-18 23:02 101  
[   ]it.mobimentum.dualsimwidget.json2023-05-18 15:34 101  
[   ]me.danielbarnett.addresstogps.json2023-05-18 00:16 101  
[   ]negativedensity.techahashi.json2023-05-17 20:26 101  
[   ]net.sourceforge.wifiremoteplay.json2023-06-04 12:15 101  
[   ]org.developfreedom.ccdroid.app.json2023-05-15 18:45 101  
[   ]org.dyndns.sven_ola.debian_kit.json2023-05-23 21:15 101  
[   ]org.github.henryquan.animeone.json2023-05-23 18:25 101  
[   ]org.openintents.flashlight.json2023-05-28 10:26 101  
[   ]org.pixmob.freemobile.netstat.json2023-05-28 07:27 101  
[   ]org.secuso.privacyfriendly2048.json2023-05-22 17:40 101  
[   ]org.tigase.messenger.phone.pro.json2023-05-22 10:30 101  
[   ]org.tmurakam.presentationtimer.json2023-05-22 10:27 101  
[   ]pl.net.szafraniec.NFCTagmaker.json2023-05-22 03:38 101  
[   ]tomer.com.alwaysonamoledplugin.json2023-06-03 06:39 101  
[   ]uk.co.keepawayfromfire.screens.json2023-05-21 18:46 101  
[   ]uk.co.yahoo.p1rpp.secondsclock.json2023-06-03 06:35 101  
[   ]app.reading.stoic.stoicreading2.json2023-04-29 01:31 102  
[   ]be.brunoparmentier.wifikeyshare.json2023-04-28 23:27 102  
[   ]ca.mudar.fairphone.peaceofmind.json2023-04-28 22:41 102  
[   ]com.adstrosoftware.launchappops.json2023-04-28 20:28 102  
[   ]com.casimirlab.simpleDeadlines.json2023-06-05 09:26 102  
[   ]com.commonsware.android.arXiv.json2023-06-05 09:13 102  
[   ]com.corphish.nightlight.generic.json2023-06-05 09:13 102  
[   ]com.dje.openwifinetworkremover.json2023-06-05 09:04 102  
[   ]com.dozingcatsoftware.asciicam.json2023-06-05 08:56 102  
[   ]com.eneko.hexcolortimewallpaper.json2023-04-28 01:57 102  
[   ]com.example.flutter_http_server.json2023-04-28 00:54 102  
[   ]com.github.palmcalc2019.palmcalc.json2023-04-27 16:45 102  
[   ]com.github.samotari.paynoway.json2023-06-02 10:07 102  
[   ]com.google.android.diskusage.json2023-04-27 15:26 102  
[   ]com.google.android.location.json2023-04-27 15:29 102  
[   ]com.jakewharton.sdksearch.json2023-04-27 10:27 102  
[   ]com.jesperh.showyoutubedislikes.json2023-04-27 09:39 102  
[   ]com.kyakujin.android.tagnotepad.json2023-07-10 12:42 102  
[   ]com.paranoid.ParanoidWallpapers.json2023-04-26 16:18 102  
[   ]com.pixiv.muzei.pixivsource.json2023-04-26 14:59 102  
[   ]com.simplemobiletools.contacts.json2023-04-26 09:52 102  
[   ]com.soumikshah.investmenttracker.json2023-04-26 07:55 102  
[   ]com.starapps.tools.tnefextractor.json2023-04-26 05:24 102  
[   ]com.thehoick.evergreenwishlist.json2023-04-26 03:57 102  
[   ]com.totsp.crossword.shortyz.json2023-04-26 02:23 102  
[   ]com.voidcode.diasporawebclient.json2023-04-25 22:44 102  
[   ]com.willchan.simple_random_stock.json2023-05-26 10:55 102  
[   ]com.willianveiga.countdowntimer.json2023-04-25 21:56 102  
[   ]com.xlythe.calculator.material.json2023-04-25 21:21 102  
[   ]crypto.o0o0o0o0o.games.blackjack.json2023-05-11 23:45 102  
[   ]cz.mendelu.xmarik.train_manager.json2023-05-11 22:16 102  
[   ]de.seemoo.at_tracking_detection.json2023-05-19 23:07 102  
[   ]de.ub0r.android.smsdroid.json2023-05-19 20:09 102  
[   ]dev.dworks.apps.anexplorer.pro.json2022-02-06 00:16 102  
[   ]eu.flatworld.android.slider.json2023-05-19 16:15 102  
[   ]eu.siacs.conversations.legacy.json2023-05-19 14:45 102  
[   ]fr.nicopico.dashclock.birthday.json2023-05-19 08:21 102  
[   ]io.github.project_kaat.gpsdrelay.json2023-06-02 01:13 102  
[   ]mazechazer.android.wottankquiz.json2023-05-18 09:45 102  
[   ]me.jakelane.wrapperforfacebook.json2023-05-18 00:01 102  
[   ]net.bitplane.android.microphone.json2023-07-05 09:08 102  
[   ]net.loeuillet.wifi_eap_sim_conf.json2023-06-04 21:49 102  
[   ]nodom.darkfm.inventoryguimobile.json2023-07-05 08:41 102  
[   ]nu.firetech.android.pactrack.json2023-05-16 23:49 102  
[   ]nu.firetech.android.wifiwarning.json2023-07-05 08:40 102  
[   ]org.androidsoft.app.permission.json2023-06-04 09:08 102  
[   ]org.chickenhook.startflagexploit.json2023-05-15 20:37 102  
[   ]org.cmotc.tools.rotationlockpp.json2023-05-15 20:33 102  
[   ]org.lf_net.pgpunlocker.json2023-05-28 19:43 102  
[   ]org.ligi.gobandroidhd.ai.gnugo.json2023-05-28 19:15 102  
[   ]org.miamplayer.autoairplanemode.json2023-05-28 15:49 102  
[   ]org.navitproject.navit.json2023-05-28 13:15 102  
[   ]org.schabi.nxbookmarks.owncloud.json2023-05-22 17:45 102  
[   ]org.secuso.privacyfriendlybackup.json2023-06-03 07:00 102  
[   ]org.secuso.privacyfriendlyruler.json2023-05-22 17:12 102  
[   ]org.wikimedia.commons.wikimedia.json2023-05-22 07:17 102  
[   ]pcmagas.vodafone_fu_h300s.json2023-05-22 05:11 102  
[   ]sterrenburg.github.flutterhole.json2023-06-03 06:47 102  
[   ]tk.radioactivemineral.metronome.json2023-05-21 19:52 102  
[   ]uk.co.busydoingnothing.catverbs.json2023-05-21 19:11 102  
[   ]us.lindanrandy.cidrcalculator.json2023-06-03 06:34 102  
[   ]amirz.rootless.nexuslauncher.json2023-04-29 01:51 103  
[   ]ca.pr0ps.xposed.entrustunblocker.json2023-04-28 22:38 103  
[   ]ch.rrelmy.android.batterymanager.json2023-05-27 10:22 103  
[   ]com.banasiak.coinflipext.example.json2023-06-05 11:10 103  
[   ]com.brentpanther.ethereumwidget.json2023-06-05 10:21 103  
[   ]com.brentpanther.litecoinwidget.json2023-04-28 11:04 103  
[   ]com.futurice.android.reservator.json2023-04-27 21:52 103  
[   ]com.github.axet.darknessimmunity.json2023-04-27 19:21 103  
[   ]com.github.yeriomin.smsscheduler.json2023-04-27 15:43 103  
[   ]com.gtp.showapicturetoyourfriend.json2023-04-27 14:53 103  
[   ]com.ihunda.android.binauralbeat.json2023-04-27 13:14 103  
[   ]com.kibab.android.EncPassChanger.json2023-04-27 07:51 103  
[   ]com.lindevhard.android.raspfinder.json2023-04-27 05:28 103  
[   ]com.linuxcounter.lico_update_003.json2023-04-27 05:30 103  
[   ]com.lucasdnd.unixtimeclockwidget.json2023-04-27 04:40 103  
[   ]com.mirfatif.permissionmanagerx.json2023-04-27 01:40 103  
[   ]com.outerworldapps.wairtonow.json2023-04-26 17:10 103  
[   ]com.releasestandard.scriptmanager.json2023-04-26 12:22 103  
[   ]com.threedlite.userhash.location.json2023-04-26 03:50 103  
[   ]com.vanderbie.heart_rate_monitor.json2023-04-25 23:13 103  
[   ]com.wbrawner.simplemarkdown.free.json2023-04-25 22:00 103  
[   ]com.willhauck.linconnectclient.json2023-04-25 21:56 103  
[   ]de.arnefeil.bewegungsmelder.json2023-05-11 20:12 103  
[   ]de.bloosberg.basti.childresuscalc.json2023-05-20 06:47 103  
[   ]de.cryptobitch.muelli.barcodegen.json2023-05-20 06:19 103  
[   ]de.igloffstein.maik.aRevelation.json2023-05-20 03:02 103  
[   ]de.naturalnet.zahnarztgeraeusche.json2023-05-20 00:12 103  
[   ]de.tu_darmstadt.seemoo.HardWhere.json2023-05-19 20:17 103  
[   ]de.viatorus.neo2externalkeyboard.json2023-05-19 19:43 103  
[   ]eth.matteljay.mastermindy.json2023-05-19 16:43 103  
[   ]gr.ratmole.android.Mach3Pendant.json2023-05-19 06:27 103  
[   ]in.ac.iitb.cse.cartsbusboarding.json2023-05-19 03:59 103  
[   ]io.github.tiagoshibata.gpsdclient.json2023-05-18 22:48 103  
[   ]io.gitlab.mudassir.youtubecacher.json2023-05-18 21:57 103  
[   ]io.krmanik.ankiimageocclusion.json2023-05-18 18:36 103  
[   ]italian.said.fran.theitaliansaid.json2023-05-18 16:33 103  
[   ]nerd.tuxmobil.fahrplan.congress.json2023-06-05 03:50 103  
[   ]net.bierbaumer.otp_authenticator.json2023-05-17 14:07 103  
[   ]net.everythingandroid.smspopup.json2023-06-04 23:02 103  
[   ]net.majorkernelpanic.spydroid.json2023-05-17 10:58 103  
[   ]net.nhiroki.bluesquarespeedometer.json2023-06-04 20:27 103  
[   ]net.ralphbroenink.muzei.unsplash.json2023-05-17 02:26 103  
[   ]network.loki.messenger.fdroid.json2023-06-04 11:15 103  
[   ]nodomain.vanous.blitztypekeyboard.json2023-06-04 10:39 103  
[   ]org.androidappdev.batterywidget.json2023-05-16 22:09 103  
[   ]org.androidsoft.games.memory.tux.json2023-06-04 09:05 103  
[   ]org.elijaxapps.androidxmrigminer.json2023-05-23 21:02 103  
[   ]org.godotengine.editor.v3.json2023-05-23 16:45 103  
[   ]org.hoi_polloi.android.ringcode.json2023-05-23 16:00 103  
[   ]org.microg.nlp.backend.apple.json2023-05-28 15:39 103  
[   ]org.penghuang.tools.rotationlock.json2023-05-23 02:31 103  
[   ]org.sufficientlysecure.viewer.json2023-05-22 13:04 103  
[   ]raffarti.simpleadvancedmetronome.json2023-05-22 03:01 103  
[   ]at.mikenet.serbianlatintocyrillic.json2023-04-29 00:09 104  
[   ]ch.gassenarbeit.bern.your.rights.json2023-05-24 09:34 104  
[   ]com.brillenheini.deepscratch.free.json2023-04-28 11:04 104  
[   ]com.easwareapps.transparentwidget.json2023-04-28 03:13 104  
[   ]com.germainz.activityforcenewtask.json2023-04-27 20:56 104  
[   ]com.github.gianlucanitti.expreval.json2023-04-27 17:57 104  
[   ]com.github.jtjj222.sudburytransit.json2023-04-27 17:36 104  
[   ]com.gmail.afonsotrepa.pocketgopher.json2023-04-27 15:33 104  
[   ]com.gmail.jerickson314.sdscanner.json2023-04-27 15:33 104  
[   ]com.google.zxing.client.android.json2023-04-27 15:04 104  
[   ]com.jwetherell.heart_rate_monitor.json2023-04-27 08:22 104  
[   ]com.lgallardo.qbittorrentclient.json2023-04-27 06:44 104  
[   ]com.liveplayergames.finneypoker.json2023-04-27 05:28 104  
[   ]com.nathaniel.motus.umlclasseditor.json2023-04-27 00:12 104  
[   ]com.nightshadelabs.anotherbrowser.json2023-04-26 20:53 104  
[   ]com.pierreduchemin.punchlinebingo.json2023-04-26 15:19 104  
[   ]com.quaap.computationaldemonology.json2023-04-26 13:25 104  
[   ]com.teamdc.stephendiniz.autoaway.json2023-04-26 04:14 104  
[   ]com.vackosar.searchbasedlauncher.json2023-04-25 23:14 104  
[   ]com.weicheng.taipeiyoubikeoffline.json2023-04-25 22:00 104  
[   ]com.xtreak.notificationdictionary.json2023-04-25 21:19 104  
[   ]de.cryptobitch.muelli.vouchercalc.json2023-05-20 06:19 104  
[   ]de.example.fahrraddiebstahl_berlin.json2023-05-20 03:43 104  
[   ]eu.schmidt.systems.opensyncedlists.json2023-05-19 14:54 104  
[   ]fr.ac_versailles.dane.xiaexpress.json2023-05-19 13:53 104  
[   ]io.github.droidapps.pdfreader.json2023-05-19 01:28 104  
[   ]io.github.martinschneider.juvavum.json2023-05-19 00:07 104  
[   ]io.mkg20001.arubanetworkslogin.json2023-05-18 18:32 104  
[   ]me.alexghr.bulkshare.android.app2.json2023-05-18 01:26 104  
[   ]me.guillaumin.android.osmtracker.json2023-05-18 00:09 104  
[   ]org.androidfromfrankfurt.archnews.json2023-05-16 22:17 104  
[   ]org.androidsoft.games.puzzle.kids.json2023-05-16 22:07 104  
[   ]org.congresointeractivo.elegilegi.json2023-05-15 20:30 104  
[   ]org.ocsinventoryng.android.agent.json2023-05-28 12:44 104  
[   ]org.polaric.cyanogenmodchangelog.json2023-05-23 02:16 104  
[   ]org.solovyev.android.calculator.json2023-05-22 15:59 104  
[   ]uk.co.jarofgreen.JustADamnCompass.json2023-06-03 06:35 104  
[   ]unisiegen.photographers.activity.json2023-05-21 18:23 104  
[   ]com.emmanuelmess.simpleaccounting.json2023-04-28 02:04 105  
[   ]com.episode6.android.appalarm.pro.json2023-06-03 11:33 105  
[   ]com.fredhappyface.ewesticker.json2023-04-27 22:11 105  
[   ]com.github.k1rakishou.chan.fdroid.json2023-04-27 17:33 105  
[   ]com.jmstudios.pointandhit.android.json2023-04-27 09:06 105  
[   ]com.monead.games.android.sequence.json2023-04-27 01:02 105  
[   ]com.shahul3d.indiasatelliteweather.json2023-04-26 10:12 105  
[   ]com.trianguloy.continuousDataUsage.json2023-04-26 02:18 105  
[   ]com.xvzan.simplemoneytracker.json2023-04-25 21:19 105  
[   ]de.enaikoon.android.keypadmapper3.json2023-05-20 04:07 105  
[   ]de.kromke.andreas.safmediascanner.json2023-05-20 01:58 105  
[   ]eu.veldsoft.svarka.odds.calculator.json2023-05-10 23:29 105  
[   ]fr.odrevet.kingdomino_score_count.json2023-05-19 08:00 105  
[   ]io.github.otobikb.inputmethod.latin.json2023-05-18 23:21 105  
[   ]io.github.powerinside.scrollsocket.json2023-05-18 23:23 105  
[   ]ml.vivekthazhathattil.chalachithram.json2023-06-05 05:22 105  
[   ]name.livitski.games.puzzle.android.json2023-06-05 04:18 105  
[   ]net.yxejamir.misbotheringsms.json2023-06-04 10:59 105  
[   ]omegacentauri.mobi.simplestopwatch.json2023-06-04 10:32 105  
[   ]org.androidsoft.games.memory.kids.json2023-06-04 09:08 105  
[   ]org.debian.eugen.headingcalculator.json2023-05-15 19:08 105  
[   ]org.inventati.massimol.liberovocab.json2023-05-23 15:41 105  
[   ]org.scotthamilton.trollslate.json2023-06-18 10:16 105  
[   ]tmendes.com.analyticalbalancedroid.json2023-06-03 06:39 105  
[   ]cf.theonewiththebraid.guerrilla_mail.json2023-04-28 22:17 106  
[   ]com.alaskalinuxuser.justcraigslist.json2023-04-28 20:25 106  
[   ]com.bottleworks.dailymoney.json2023-04-28 11:57 106  
[   ]com.fisheradelakin.interactivestory.json2023-04-28 00:08 106  
[   ]com.harleensahni.android.mbr.json2023-04-27 13:55 106  
[   ]com.menny.anysoftkeyboard.finnish.json2023-04-27 02:05 106  
[   ]com.radiostudent.radiostudentstream.json2023-04-26 13:07 106  
[   ]com.tkjelectronics.balanduino.json2023-04-26 03:33 106  
[   ]com.zoffcc.applications.avifview.json2023-06-02 09:38 106  
[   ]edu.stanford.rkpandey.covid19tracker.json2023-05-19 17:06 106  
[   ]fr.tvbarthel.apps.simplethermometer.json2023-05-19 07:38 106  
[   ]info.metadude.android.gpn.schedule.json2023-05-23 22:39 106  
[   ]io.github.trytonvanmeer.libretrivia.json2023-05-18 22:50 106  
[   ]io.librehealth.toolkit.cost_of_care.json2023-05-18 18:36 106  
[   ]nodomain.freeyourgadget.tpmsmonitor.json2023-06-04 10:40 106  
[   ]org.secuso.privacyfriendlypaindiary.json2023-05-22 17:23 106  
[   ]rs.pedjaapps.alogcatroot.app.json2023-05-22 02:37 106  
[   ]app.pott.kaffeepott.androidclient.json2021-03-13 10:04 107  
[   ]com.anysoftkeyboard.languagepack.SSH.json2023-06-05 11:18 107  
[   ]com.blogspot.developersu.ns_usbloader.json2023-06-05 11:06 107  
[   ]com.blogspot.tonyatkins.freespeech.json2023-04-28 12:17 107  
[   ]com.daviancorp.android.mh4udatabase.json2023-06-10 10:53 107  
[   ]com.github.andremiras.qrscan.json2023-04-27 20:31 107  
[   ]com.github.timnew.smartremotecontrol.json2023-06-03 11:05 107  
[   ]com.gitlab.kreikenbaum.suntime.fdroid.json2023-09-14 08:11 107  
[   ]com.hlidskialf.android.pomodoro.json2023-04-27 13:34 107  
[   ]com.juliansparber.captiveportallogin.json2023-04-27 08:36 107  
[   ]com.lgallardo.qbittorrentclientpro.json2023-04-27 05:36 107  
[   ]com.lucasdnd.decimaltimeclockwidget.json2023-07-10 09:50 107  
[   ]com.mathi_amorim.emmanuel.metrictime.json2023-04-27 02:55 107  
[   ]com.minimalisticapps.priceconverter.json2023-04-27 01:55 107  
[   ]com.netvor.settings.database.provider.json2023-05-27 08:42 107  
[   ]com.rascarlo.adaptive.brightness.tile.json2023-04-26 12:52 107  
[   ]com.rogerbassonsrenart.paddletennis.json2023-04-26 12:02 107  
[   ]com.trianguloy.numericriddlegenerator.json2023-06-03 10:44 107  
[   ]com.vonglasow.michael.voltagedrop.json2023-04-25 22:39 107  
[   ]de.hoppfoundation.klassenzimmer.json2023-05-20 03:02 107  
[   ]de.k3b.android.contentproviderhelper.json2023-05-20 02:20 107  
[   ]de.xskat.json2022-02-05 22:50 107  
[   ]eu.siacs.conversations.voicerecorder.json2023-05-19 14:44 107  
[   ]info.metadude.android.hope.schedule.json2023-07-17 06:08 107  
[   ]it.diab.json2023-05-18 16:03 107  
[   ]it.sineo.android.noFrillsCPUClassic.json2023-05-18 13:25 107  
[   ]net.sourceforge.subsonic.androidapp.json2023-05-17 01:12 107  
[   ]nz.org.cacophony.birdmonitor.json2023-05-16 23:46 107  
[   ]org.sufficientlysecure.termbot.json2023-05-22 13:04 107  
[   ]tn.creativeteam.newyoutubelistingapp.json2023-05-21 19:52 107  
[   ]com.EthanHeming.NeuralNetworkSimulator.json2023-04-28 01:06 108  
[   ]com.adrienpoupa.attestationcoronavirus.json2023-04-28 20:28 108  
[   ]com.anysoftkeyboard.languagepack.pali.json2023-05-24 05:24 108  
[   ]com.catchingnow.tinyclipboardmanager.json2023-06-05 09:24 108  
[   ]com.developfreedom.wordpowermadeeasy.json2023-06-05 09:06 108  
[   ]com.example.root.analyticaltranslator.json2023-04-28 00:40 108  
[   ]com.freezingwind.animereleasenotifier.json2023-04-27 22:08 108  
[   ]com.github.characterdog.bmicalculator.json2023-04-27 18:19 108  
[   ]com.github.gschwind.fiddle_assistant.json2023-04-27 17:46 108  
[   ]com.github.nicolassmith.urlevaluator.json2023-06-03 11:07 108  
[   ]com.gulshansingh.hackerlivewallpaper.json2023-04-27 14:52 108  
[   ]com.intrications.android.sharebrowser.json2023-04-27 12:04 108  
[   ]com.kaneoriley.cyanogenport.launcher3.json2023-04-27 08:06 108  
[   ]com.myopicmobile.textwarrior.android.json2023-04-27 00:28 108  
[   ]com.simonslater.guitarfretboardtrainer.json2023-12-15 04:52 108  
[   ]de.bitsharesmunich.smartcoinswallet.json2023-05-20 07:32 108  
[   ]de.drhoffmannsoftware.xearth.json2023-05-20 04:13 108  
[   ]edu.cmu.cylab.starslinger.demo.json2023-05-19 17:21 108  
[   ]fr.herverenault.selfhostedgpstracker.json2023-05-19 08:44 108  
[   ]fr.jakse.raphael.simpleprotocolplayer.json2023-05-19 08:43 108  
[   ]fr.simon.marquis.preferencesmanager.json2023-05-19 07:41 108  
[   ]horse.amazin.my.stratum0.statuswidget.json2023-05-19 06:19 108  
[   ]io.github.domi04151309.podscompanion.json2023-05-19 01:28 108  
[   ]io.github.thachillera.cardsscorekeeper.json2023-05-18 22:50 108  
[   ]kaljurand_at_gmail_dot_com.diktofon.json2023-05-18 12:05 108  
[   ]org.bitbucket.tickytacky.mirrormirror.json2023-06-04 07:16 108  
[   ]org.developfreedom.wordpowermadeeasy.json2023-05-15 18:17 108  
[   ]org.fitchfamily.android.wifi_backend.json2023-05-23 20:08 108  
[   ]org.kiwix.kiwixcustomwikivoyageeurope.json2023-02-06 23:03 108  
[   ]org.malinux.lectureFrancais.actLecture.json2023-05-23 09:35 108  
[   ]org.mattvchandler.progressbars.json2023-05-28 16:17 108  
[   ]org.projectvoodoo.screentestpatterns.json2023-05-23 01:47 108  
[   ]org.secuso.privacyfriendlycardgameone.json2023-05-22 17:38 108  
[   ]org.secuso.privacyfriendlytapemeasure.json2023-05-22 17:10 108  
[   ]pro.rudloff.lineageos_updater_shortcut.json2023-05-22 03:21 108  
[   ]uk.co.danieljarvis.android.flashback.json2023-06-03 06:36 108  
[   ]com.alaskalinuxuser.shipcaptainandcrew.json2023-06-05 11:24 109  
[   ]com.eightsines.firestrike.opensource.json2023-06-05 08:53 109  
[   ]com.github.andremiras.etheroll.json2021-03-09 23:12 109  
[   ]com.github.niccokunzmann.hanumanchalisa.json2023-04-27 16:49 109  
[   ]com.github.samotari.cryptoterminal.json2023-06-02 01:57 109  
[   ]com.github.yeriomin.dumbphoneassistant.json2023-04-27 15:43 109  
[   ]com.jroddev.android_oss_release_tracker.json2023-05-26 15:35 109  
[   ]de.mbutscher.wikiandpad.alphabeta.json2023-05-20 01:30 109  
[   ]fr.tvbarthel.apps.simpleweatherforcast.json2023-05-19 07:38 109  
[   ]name.starnberger.guenther.android.cbw.json2023-05-17 20:27 109  
[   ]org.secuso.privacyfriendlyintervaltimer.json2023-05-22 17:34 109  
[   ]pro.oblivioncoding.fluffy_board.json2023-05-22 03:23 109  
[   ]tk.jordynsmediagroup.simpleirc.fdroid.json2023-05-21 20:13 109  
[   ]androdns.android.leetdreams.ch.androdns.json2023-04-29 01:50 110  
[   ]be.brunoparmentier.openbikesharing.app.json2023-04-28 23:29 110  
[   ]com.example.android.monthcalendarwidget.json2023-04-28 00:57 110  
[   ]com.github.characterdog.share_my_number.json2023-04-27 18:19 110  
[   ]com.google.android.apps.authenticator2.json2023-04-27 15:27 110  
[   ]com.prhlt.aemus.Read4SpeechExperiments.json2023-04-26 13:29 110  
[   ]com.rhiannonweb.android.migrainetracker.json2023-04-26 12:12 110  
[   ]com.vsmartcard.remotesmartcardreader.app.json2023-04-25 22:38 110  
[   ]com.wa2c.android.cifsdocumentsprovider.json2023-04-25 22:35 110  
[   ]de.jonasbernard.tudarmstadtmoodlewrapper.json2023-07-15 07:46 110  
[   ]de.nodomain.tobihille.seniorlauncher.json2023-05-20 00:10 110  
[   ]de.salomax.muzei.thevergewallpapers.json2023-06-02 09:29 110  
[   ]info.metadude.android.pyconza.schedule.json2023-05-19 02:45 110  
[   ]net.androcom.dho.speakerproximity.json2023-10-29 07:18 110  
[   ]org.greatfire.wikiunblocked.fdroid.json2023-07-16 07:06 110  
[   ]org.pareudepararme.pareu_de_pararme_map.json2023-05-23 02:40 110  
[   ]com.anysoftkeyboard.languagepack.tatar.json2023-05-24 05:22 111  
[   ]com.github.notizklotz.derbunddownloader.json2023-06-02 10:08 111  
[   ]com.tiwa.pl.json2023-04-26 03:43 111  
[   ]net.georgewhiteside.android.abstractart.json2023-06-04 22:48 111  
[   ]net.opendasharchive.openarchive.release.json2023-05-17 09:54 111  
[   ]org.ametro.json2023-06-04 09:19 111  
[   ]org.secuso.privacyfriendlyboardgameclock.json2023-05-22 17:39 111  
[   ]telegra.ph.json2023-06-03 06:40 111  
[   ]ca.cmetcalfe.xposed.flatconnectivityicons.json2023-04-28 22:42 112  
[   ]com.androidfromfrankfurt.workingtimealert.json2023-04-28 19:46 112  
[   ]com.anysoftkeyboard.languagepack.french.json2023-05-24 05:26 112  
[   ]com.aptasystems.dicewarepasswordgenerator.json2023-06-05 11:17 112  
[   ]com.github.andremiras.zbarcamdemo.json2023-04-27 20:30 112  
[   ]com.seawolfsanctuary.keepingtracks.json2023-04-26 11:10 112  
[   ]com.theksmith.android.car_bus_interface.json2023-04-26 03:53 112  
[   ]io.github.webbluetoothcg.bletestperipheral.json2023-05-18 22:41 112  
[   ]me.zhanghai.android.textselectionwebsearch.json2023-05-17 22:41 112  
[   ]name.seguri.android.getforegroundactivity.json2023-06-05 04:15 112  
[   ]org.geometerplus.fbreader.plugin.tts.json2023-05-29 00:53 112  
[   ]org.sufficientlysecure.standalonecalendar.json2023-05-22 13:15 112  
[   ]starcom.snd.json2023-05-21 21:47 112  
[   ]ca.momi.lift.json2023-04-28 22:41 113  
[   ]com.anysoftkeyboard.languagepack.catalan.json2023-05-24 05:27 113  
[   ]com.anysoftkeyboard.languagepack.malayalam.json2023-06-05 11:19 113  
[   ]com.anysoftkeyboard.languagepack.slovene.json2023-05-24 05:23 113  
[   ]com.anysoftkeyboard.languagepack.swedish.json2023-05-24 05:22 113  
[   ]com.shatteredpixel.shatteredpixeldungeon.json2023-04-26 10:03 113  
[   ]de.antonfluegge.android.yubnubwidgetadfree.json2023-05-11 20:11 113  
[   ]de.kugihan.dictionaryformids.hmi_android.json2023-05-20 01:48 113  
[   ]de.ub0r.android.websms.connector.gmx.json2023-05-19 20:10 113  
[   ]org.geometerplus.zlibrary.ui.android.json2023-05-29 00:57 113  
[   ]org.projectvoodoo.simplecarrieriqdetector.json2023-05-27 06:47 113  
[   ]org.secuso.privacyfriendlypausinghealthily.json2023-05-22 17:16 113  
[   ]org.spechide.btappnder.whatsapptransmitter.json2023-05-22 13:51 113  
[   ]org.unifiedpush.distributor.noprovider2push.json2023-05-22 08:40 113  
[   ]com.anysoftkeyboard.languagepack.icelandic.json2023-05-24 05:25 114  
[   ]com.example.tobiastrumm.freifunkautoconnect.json2023-04-28 00:39 114  
[   ]com.ideasfrombrain.search_based_launcher_v2.json2023-04-27 13:17 114  
[   ]com.vecturagames.android.app.passwordmaster.json2023-04-25 23:11 114  
[   ]de.neuwirthinformatik.alexander.archerystats.json2023-06-03 10:34 114  
[   ]info.metadude.android.libreoffice.schedule.json2023-05-19 02:45 114  
[   ]it.collideorscopeapps.codename_hippopotamos.json2023-05-18 16:29 114  
[   ]org.tuxpaint.json2023-05-22 09:16 114  
[   ]com.anysoftkeyboard.languagepack.afrikaans.json2023-06-04 00:41 115  
[   ]com.anysoftkeyboard.languagepack.dutch_oss.json2023-06-04 00:40 115  
[   ]com.anysoftkeyboard.languagepack.ukrainian.json2023-05-24 05:22 115  
[   ]com.unwrappedapps.android.wallpaper.creative.json2023-04-25 23:17 115  
[   ]de.Cherubin7th.blackscreenpresentationremote.json2023-05-20 06:40 115  
[   ]de.szalkowski.activitylauncher.rustore_fork.json2023-05-19 21:54 115  
[   ]org.jsl.wfwt.json2023-05-28 21:33 115  
[   ]zame.GloomyDungeons.opensource.game.json2023-06-01 11:44 115  
[   ]com.anysoftkeyboard.languagepack.indonesian.json2023-06-05 11:19 116  
[   ]com.anysoftkeyboard.languagepack.macedonian.json2023-05-24 05:25 116  
[   ]com.anysoftkeyboard.languagepack.ossturkish.json2023-06-05 11:19 116  
[   ]com.developerfromjokela.motioneyeclient.json2023-06-10 10:53 116  
[   ]com.github.olga_yakovleva.rhvoice.android.json2023-04-27 16:48 116  
[   ]com.martinborjesson.o2xtouchlednotifications.json2023-04-27 03:15 116  
[   ]info.metadude.android.bitsundbaeume.schedule.json2023-05-19 03:03 116  
[   ]chromiumupdater.bamless.com.chromiumsweupdater.json2023-05-27 10:22 117  
[   ]com.chao.app.json2023-07-15 08:39 117  
[   ]com.corner23.android.beautyclocklivewallpaper.json2023-06-05 09:13 117  
[   ]com.daviancorp.android.monsterhunter3udatabase.json2023-06-05 09:07 117  
[   ]com.hyperionics.fbreader.plugin.tts_plus.json2023-04-27 13:28 117  
[   ]com.tht.k3pler.json2023-04-26 03:49 117  
[   ]com.zoffcc.applications.metalab_open_widget.json2023-04-25 20:42 117  
[   ]de.nellessen.usercontrolleddecryptionoperations.json2023-05-20 00:10 117  
[   ]jp.co.kayo.android.localplayer.ds.ampache.json2023-05-18 12:34 117  
[   ]me.lucky.volta.json2023-12-14 09:14 117  
[   ]net.kismetwireless.android.smarterwifimanager.json2023-06-04 21:59 117  
[   ]com.tobiaskuban.android.monthcalendarwidgetfoss.json2023-04-26 03:28 118  
[   ]cz.hernik.kaku.json2023-05-11 22:33 118  
[   ]jp.co.kayo.android.localplayer.ds.podcast.json2023-05-18 12:33 118  
[   ]org.dkf.jmule.json2023-05-23 21:47 118  
[   ]org.zamedev.gloomydungeons2.opensource.json2023-05-22 05:40 118  
[   ]rs.ltt.android.json2023-05-22 02:37 118  
[   ]com.anysoftkeyboard.languagepack.afrikaans_oss.json2023-06-04 00:41 119  
[   ]com.anysoftkeyboard.languagepack.hungarian_oss.json2023-06-04 00:39 119  
[   ]com.evilinsult.json2023-04-28 00:55 119  
[   ]com.heb12.heb12.json2023-04-27 13:34 119  
[   ]com.holokenmod.json2023-04-27 13:21 119  
[   ]com.matt.bolton.json2023-04-27 02:51 119  
[   ]com.nima.mymood.json2023-06-05 08:35 119  
[   ]dubrowgn.wattz.json2023-05-19 17:29 119  
[   ]im.pattle.app.json2022-02-05 11:48 119  
[   ]jl.musicalnotes.json2023-05-18 13:09 119  
[   ]me.lucky.sentry.json2023-06-05 06:42 119  
[   ]net.osmtracker.json2023-06-04 14:09 119  
[   ]com.rechnen.app.json2023-04-26 12:39 120  
[   ]de.ub0r.android.websms.connector.smspilotru.json2023-05-19 20:08 120  
[   ]dk.jens.backup.json2023-05-19 18:08 120  
[   ]me.lucky.duress.json2023-06-05 06:42 120  
[   ]me.thanel.dank.json2023-06-05 06:17 120  
[   ]org.broeuschmeul.android.gps.bluetooth.provider.json2023-05-16 07:03 120  
[   ]org.sensors2.pd.json2023-05-22 16:51 120  
[   ]ro.ioanm.fissh.json2023-05-22 02:48 120  
[   ]com.adam.aslfms.json2023-06-04 02:31 121  
[   ]com.chess.clock.json2023-06-05 09:20 121  
[   ]com.ero.kinoko.json2023-06-10 10:42 121  
[   ]com.headi.app.json2023-04-27 13:51 121  
[   ]com.tss.android.json2023-04-26 02:16 121  
[   ]de.monocles.mail.json2023-05-20 00:15 121  
[   ]io.rebble.charon.json2023-05-18 18:11 121  
[   ]is.zi.huewidgets.json2023-05-18 16:31 121  
[   ]me.lucky.wasted.json2023-06-05 06:33 121  
[   ]net.gitsaibot.af.json2023-05-17 13:10 121  
[   ]net.ser1.forage.json2023-06-04 12:54 121  
[   ]org.mcxa.vortaro.json2023-05-28 16:05 121  
[   ]org.seamapdroid.json2023-05-22 17:39 121  
[   ]cc.calliope.mini.json2023-04-28 22:23 122  
[   ]com.powerje.nyan.json2023-12-15 05:30 122  
[   ]com.slothwerks.hearthstone.compendiumforhearthstone.json2023-04-26 07:58 122  
[   ]com.smithdtyler.prettygoodmusicplayer.launchermode.json2023-04-26 07:56 122  
[   ]miccah.mpvremote.json2023-06-05 05:59 122  
[   ]org.stypox.dicio.json2023-06-02 07:11 122  
[   ]se.lublin.mumla.json2023-05-22 00:18 122  
[   ]com.adgad.kboard.json2023-06-05 11:26 123  
[   ]com.alovoa.alovoa.json2023-06-10 11:16 123  
[   ]com.aravi.dot.json2023-05-24 05:06 123  
[   ]com.jstephan.yarc.json2023-04-27 08:40 123  
[   ]com.mookie.circo.json2023-04-27 00:42 123  
[   ]com.nicue.onetwo.json2023-04-26 20:56 123  
[   ]de.moroway.oc.json2023-05-20 00:15 123  
[   ]me.iacn.mbestyle.json2023-06-05 06:51 123  
[   ]me.jfenn.alarmio.json2023-06-05 06:46 123  
[   ]me.lucky.silence.json2023-06-05 06:42 123  
[   ]nekox.messenger.json2023-06-05 04:09 123  
[   ]net.taler.cashier.json2023-06-04 12:12 123  
[   ]org.ebur.debitum.json2023-05-29 03:05 123  
[   ]app.varlorg.unote.json2023-04-29 01:02 124  
[   ]com.enrico.sample.json2023-06-05 08:51 124  
[   ]com.itds.sms.ping.json2023-04-27 10:37 124  
[   ]com.notecryptpro.json2023-04-26 19:00 124  
[   ]moe.feng.nhentai.json2023-06-05 05:14 124  
[   ]ooo.akito.webmon.json2023-06-04 10:07 124  
[   ]org.privacyhelper.json2023-05-28 07:06 124  
[   ]ru.gelin.android.weather.notification.skin.blacktext.json2023-05-22 02:33 124  
[   ]ru.gelin.android.weather.notification.skin.whitetext.json2023-05-22 02:06 124  
[   ]app.fedilab.lite.json2021-03-13 09:53 125  
[   ]com.manuelmaly.hn.json2023-07-10 09:25 125  
[   ]com.quaap.primary.json2023-04-26 13:17 125  
[   ]de.duenndns.gmdice.json2023-05-20 04:07 125  
[   ]in.indiandragon.shellshock.shellshockvulnerabilityscan.json2023-05-19 02:18 125  
[   ]ltd.evilcorp.atox.json2023-05-18 10:00 125  
[   ]mf.asciitext.lite.json2023-06-05 05:57 125  
[   ]net.pp3345.ykdroid.json2023-06-04 13:29 125  
[   ]org.afhdownloader.json2023-06-04 09:40 125  
[   ]ru.gelin.android.weather.notification.skin.biggertext.json2023-05-22 02:36 125  
[   ]truewatcher.tower.json2023-06-03 06:38 125  
[   ]btools.routingapp.json2023-04-28 23:02 126  
[   ]com.chen.deskclock.json2023-06-05 09:21 126  
[   ]com.dougkeen.bart.json2023-06-05 08:57 126  
[   ]com.gbeatty.arxiv.json2023-04-27 21:32 126  
[   ]com.viper.simplert.json2023-04-25 22:51 126  
[   ]de.baumann.sieben.json2023-05-11 19:10 126  
[   ]it.gmariotti.android.apps.dashclock.extensions.battery.json2023-05-18 15:46 126  
[   ]mattecarra.accapp.json2023-05-18 01:46 126  
[   ]org.anothermonitor.json2023-06-04 08:53 126  
[   ]ademar.textlauncher.json2023-04-29 01:56 127  
[   ]bluepie.ad_silence.json2023-04-28 23:15 127  
[   ]com.caydey.ffshare.json2023-07-14 08:59 127  
[   ]com.oF2pks.netscope.json2021-03-09 08:40 127  
[   ]com.pjuu.otterdroid.json2023-04-26 14:45 127  
[   ]dev.lonami.klooni.json2023-05-19 19:41 127  
[   ]eu.quelltext.memory.json2023-05-19 14:58 127  
[   ]it.skarafaz.mercury.json2023-05-18 13:23 127  
[   ]net.xvello.salasana.json2023-07-05 08:43 127  
[   ]org.geometerplus.fbreader.plugin.local_opds_scanner.json2023-05-29 00:55 127  
[   ]cf.fridays.fff_info.json2023-04-28 22:21 128  
[   ]ch.hgdev.toposuite.json2023-04-28 21:52 128  
[   ]com.jmstudios.chibe.json2023-04-27 09:11 128  
[   ]com.lucao.limpazap.json2023-07-10 09:51 128  
[   ]com.memetro.android.json2023-06-02 01:49 128  
[   ]com.sanskritbasics.json2023-04-26 11:28 128  
[   ]com.uberspot.a2048.json2023-04-26 00:14 128  
[   ]com.wattwurm.toodoo.json2023-06-05 08:24 128  
[   ]de.blocklink.pigrid.json2023-05-20 06:48 128  
[   ]in.andres.kandroid.json2023-05-19 03:27 128  
[   ]me.echeung.cdflabs.json2023-06-05 07:04 128  
[   ]net.syncthing.lite.json2023-06-04 12:13 128  
[   ]org.floens.chan.json2023-05-29 02:11 128  
[   ]org.tether.tether.json2023-05-22 11:09 128  
[   ]app.fedilab.tubelab.json2023-04-29 01:43 129  
[   ]br.com.colman.nato.json2023-07-10 17:58 129  
[   ]ca.hamaluik.timecop.json2023-06-05 11:29 129  
[   ]com.benny.pxerstudio.json2023-06-05 11:09 129  
[   ]com.lako.walletcount.json2023-07-10 12:31 129  
[   ]com.mhss.app.mybrain.json2023-05-26 14:51 129  
[   ]com.nyxkn.meditation.json2023-06-05 08:35 129  
[   ]com.pvpc.precio_luz.json2023-04-26 13:28 129  
[   ]com.rfo.LASKmobile.json2023-04-26 12:22 129  
[   ]com.zionhuang.music.json2023-06-02 09:38 129  
[   ]danielmeek32.compass.json2023-05-11 20:15 129  
[   ]de.determapp.android.json2023-05-20 04:36 129  
[   ]de.grobox.blitzmail.json2023-05-20 03:19 129  
[   ]de.mwvb.blockpuzzle.json2023-05-20 00:12 129  
[   ]dev.melonpan.kotori.json2023-05-19 19:31 129  
[   ]felixwiemuth.lincal.json2023-05-19 14:23 129  
[   ]fr.emersion.goguma.json2023-05-31 07:05 129  
[   ]io.bmaupin.pitchpipe.json2023-06-05 08:07 129  
[   ]oppen.gemini.ariane.json2023-06-04 09:40 129  
[   ]org.biotstoiq.launch.json2023-06-04 07:24 129  
[   ]org.stypox.tridenta.json2023-06-04 06:34 129  
[   ]org.tengel.timescale.json2023-05-22 11:23 129  
[   ]protect.videoeditor.json2023-05-22 03:06 129  
[   ]ru.hyst329.openfool.json2023-05-22 01:32 129  
[   ]com.android.todolist.json2023-05-24 05:46 130  
[   ]com.dkanada.openapk.json2023-04-28 04:35 130  
[   ]de.mangelow.debdroid.json2023-05-20 01:39 130  
[   ]eu.mrogalski.saidit.json2023-05-19 15:42 130  
[   ]fr.xtof54.mousetodon.json2023-05-19 07:15 130  
[   ]io.oversec.one.json2023-05-18 18:23 130  
[   ]jackpal.androidterm.json2023-05-18 13:15 130  
[   ]juliushenke.smarttt.json2023-05-18 12:18 130  
[   ]me.dbarnett.acastus.json2023-06-14 17:30 130  
[   ]org.segin.ttleditor.json2023-05-22 16:52 130  
[   ]science.iodev.fissh.json2023-05-22 00:39 130  
[   ]se.anyro.nfc_reader.json2023-05-22 00:38 130  
[   ]team.swing.pendulums.json2023-05-21 20:44 130  
[   ]app.fedilab.openmaps.json2023-04-29 01:43 131  
[   ]ch.thilojaeggi.notely.json2023-05-25 14:14 131  
[   ]com.antonok.warpclock.json2023-06-05 11:20 131  
[   ]com.asdoi.quicktiles.json2023-06-05 11:16 131  
[   ]com.biotstoiq.hayago.json2023-06-05 11:07 131  
[   ]com.codedead.deadhash.json2023-06-03 16:15 131  
[   ]com.github.rsteube.t4.json2023-06-03 11:07 131  
[   ]com.inator.calculator.json2023-05-20 08:10 131  
[   ]com.mzhang.cleantimer.json2023-04-27 00:24 131  
[   ]com.pato05.uploadgram.json2023-04-26 16:03 131  
[   ]com.smilla.greentooth.json2023-04-26 07:55 131  
[   ]dev.marchello.sharik.json2023-07-15 07:21 131  
[   ]eu.dorfbrunnen.momkin.json2023-05-19 16:37 131  
[   ]info.tangential.cone.json2023-05-19 02:32 131  
[   ]io.github.dkter.aaaaa.json2023-05-19 01:28 131  
[   ]io.github.v2compose.json2023-05-27 07:59 131  
[   ]jpf.android.magiadni.json2023-05-18 12:24 131  
[   ]net.sylvek.itracing2.json2023-06-04 12:12 131  
[   ]net.typeblog.shelter.json2023-07-05 08:45 131  
[   ]org.afrikalan.tuxmath.json2023-06-04 09:38 131  
[   ]org.cuberite.android.json2023-05-15 19:09 131  
[   ]org.equeim.tremotesf.json2023-05-29 02:47 131  
[   ]org.poul.bits.android.json2023-05-28 07:20 131  
[   ]org.scoutant.blokish.json2023-05-22 17:40 131  
[   ]se.tube42.p9.android.json2023-05-22 00:05 131  
[   ]com.anoopknr.pastebin.json2023-06-05 11:20 132  
[   ]com.jithware.brethap.json2023-04-27 09:38 132  
[   ]com.sunyata.kindmind.json2023-04-26 05:00 132  
[   ]de.badaix.snapcast.json2023-05-11 20:08 132  
[   ]de.nucleus.foss_warn.json2023-06-03 10:33 132  
[   ]info.papdt.blackblub.json2023-05-19 02:41 132  
[   ]moe.minori.pgpclipper.json2023-06-05 05:01 132  
[   ]org.transdroid.lite.json2023-05-22 09:21 132  
[   ]org.xposeddownloader.json2023-05-22 05:54 132  
[   ]be.knars.netflixtoimdb.json2023-04-28 23:22 133  
[   ]cc.kafuu.bilidownload.json2023-06-04 02:39 133  
[   ]cl.coders.faketraveler.json2023-05-25 14:13 133  
[   ]com.fediphoto.lineage.json2023-04-28 00:15 133  
[   ]com.grmasa.soundtoggle.json2023-04-27 14:55 133  
[   ]com.metinkale.prayer.json2021-03-09 13:14 133  
[   ]com.phstudio.darktheme.json2023-04-26 15:19 133  
[   ]com.serwylo.retrowars.json2023-04-26 10:18 133  
[   ]com.tnibler.cryptocam.json2023-04-26 03:29 133  
[   ]com.winston69.simpill.json2023-04-25 21:55 133  
[   ]corewala.gemini.buran.json2023-07-10 09:03 133  
[   ]de.drhoffmannsoftware.json2023-05-20 04:13 133  
[   ]de.gabbo.forro_lyrics.json2023-05-20 03:23 133  
[   ]de.monocles.translator.json2023-05-20 00:15 133  
[   ]eu.webdragon.storygame.json2023-05-19 14:26 133  
[   ]me.bgregos.brighttask.json2023-06-05 07:57 133  
[   ]me.tripsit.tripmobile.json2023-06-05 06:05 133  
[   ]online.xournal.mobile.json2023-06-04 10:04 133  
[   ]org.freshrss.easyrss.json2023-05-29 01:14 133  
[   ]ua.syt0r.kanji.fdroid.json2023-12-12 07:16 133  
[   ]acr.browser.lightning.json2023-04-29 01:58 134  
[   ]bus.chio.wishmaster.json2023-04-28 23:01 134  
[   ]chat.rocket.android.json2023-05-25 14:23 134  
[   ]click.dummer.imagesms.json2023-05-27 10:21 134  
[   ]com.blazecode.tsviewer.json2023-06-09 12:43 134  
[   ]com.cityzen.cityzen.json2023-06-07 09:16 134  
[   ]com.dynamite.heaterrc.json2023-06-05 08:53 134  
[   ]com.enrico.earthquake.json2023-04-28 01:56 134  
[   ]io.pslab.json2023-05-18 18:11 134  
[   ]it.fossoft.timberfoss.json2022-02-05 01:21 134  
[   ]net.daverix.urlforward.json2023-12-14 08:22 134  
[   ]net.tjado.passwdsafe.json2023-06-04 11:48 134  
[   ]nightlock.peppercarrot.json2023-06-04 10:59 134  
[   ]com.alexkang.loopboard.json2023-06-05 11:24 135  
[   ]com.flasskamp.energize.json2023-07-10 16:17 135  
[   ]com.hobbyone.HashDroid.json2023-04-27 13:33 135  
[   ]com.kgurgul.cpuinfo.json2023-04-27 07:51 135  
[   ]com.mdiqentw.lifedots.json2023-06-02 09:53 135  
[   ]com.pocket_plan.j7_003.json2023-06-05 08:33 135  
[   ]de.chadenas.cpudefense.json2023-05-31 07:15 135  
[   ]de.j4velin.pedometer.json2023-05-20 03:01 135  
[   ]eu.roggstar.getmitokens.json2023-05-19 14:56 135  
[   ]one.librem.social.json2022-03-20 00:56 135  
[   ]org.fossasia.badgemagic.json2023-05-29 01:57 135  
[   ]org.olgsoft.apipepanic.json2023-05-28 12:41 135  
[   ]top.linesoft.open2share.json2023-06-03 06:38 135  
[   ]wtf.technodisaster.tldr.json2023-05-21 17:49 135  
[   ]com.xabber.androiddev.json2023-04-25 21:25 136  
[   ]de.baumann.quitsmoking.json2023-05-11 19:13 136  
[   ]de.mathema.privacyblur.json2023-05-20 01:22 136  
[   ]de.naturalnet.mirwtfapp.json2023-05-20 00:11 136  
[   ]fr.bellev.stdatmosphere.json2023-05-19 13:43 136  
[   ]net.ebt.muzei.miyazaki.json2023-06-04 23:10 136  
[   ]org.pulpdust.lesserpad.json2023-05-28 06:41 136  
[   ]app.fedilab.fedilabtube.json2023-04-29 01:46 137  
[   ]com.anpmech.launcher.json2023-06-09 12:54 137  
[   ]com.daniel.mobilepauker2.json2023-06-05 09:09 137  
[   ]com.enjoyingfoss.parlera.json2023-06-03 11:40 137  
[   ]com.quaap.fishberserker.json2023-04-26 13:22 137  
[   ]com.vaudibert.canidrive.json2023-04-25 23:05 137  
[   ]de.drhoffmannsoft.pizza.json2023-05-20 04:13 137  
[   ]dev.yasan.metro.fdroid.json2023-05-19 19:16 137  
[   ]eu.berdosi.app.heartbeat.json2023-05-19 16:41 137  
[   ]me.wolszon.fastshopping.json2023-06-05 06:03 137  
[   ]net.basov.lws.fdroid.json2023-06-04 23:37 137  
[   ]net.wigle.wigleandroid.json2023-06-04 11:02 137  
[   ]net.xtlive.EDL.Dashboard.json2023-06-04 11:00 137  
[   ]org.asafonov.blockbuster.json2023-06-04 08:50 137  
[   ]org.ninthfloor.copperpdf.json2023-05-28 13:08 137  
[   ]org.opengappsdownloader.json2023-05-28 12:40 137  
[   ]org.zephyrsoft.sdbviewer.json2023-05-22 05:33 137  
[   ]player.efis.data.ant.spl.json2023-05-22 05:03 137  
[   ]protect.babysleepsounds.json2023-05-22 03:17 137  
[   ]a2dp.Vol.json2023-04-29 01:58 138  
[   ]com.afollestad.nocknock.json2023-06-05 11:25 138  
[   ]com.cliambrown.easynoise.json2023-06-05 09:20 138  
[   ]com.fsck.k9.material.json2023-04-27 21:53 138  
[   ]com.gabriel.covid19stats.json2023-04-27 21:49 138  
[   ]com.iven.lfflfeedreader.json2023-04-27 10:34 138  
[   ]com.mileskrell.texttorch.json2023-12-15 07:43 138  
[   ]com.noprestige.kanaquiz.json2023-04-26 19:01 138  
[   ]com.redirectapps.tvkill.json2023-04-26 12:38 138  
[   ]com.wownero.wownerujo.json2023-04-25 21:49 138  
[   ]de.retujo.bierverkostung.json2023-05-19 23:27 138  
[   ]eu.bauerj.paperless_app.json2023-05-19 16:42 138  
[   ]flunzmas.seasoncalendar.json2023-05-19 14:10 138  
[   ]fr.kwiatkowski.ApkTrack.json2023-05-19 08:38 138  
[   ]info.meoblast001.thugaim.json2023-05-19 03:04 138  
[   ]io.gresse.hugo.anecdote.json2023-05-18 21:50 138  
[   ]io.muetsch.anchrandroid.json2023-05-18 18:21 138  
[   ]org.domogik.domodroid13.json2023-05-23 21:32 138  
[   ]org.jfedor.frozenbubble.json2023-05-28 21:37 138  
[   ]org.ligi.gobandroid_hd.json2023-05-28 19:23 138  
[   ]org.openbmap.unifiedNlp.json2023-05-28 12:41 138  
[   ]org.saiditnet.redreader.json2023-06-02 07:18 138  
[   ]org.weilbach.splitbills.json2023-05-22 07:22 138  
[   ]org.yaxim.androidclient.json2023-05-22 05:49 138  
[   ]ro.ciubex.dscautorename.json2023-05-22 02:58 138  
[   ]com.rabbitcompany.passky.json2023-06-05 08:32 139  
[   ]com.shabinder.spotiflyer.json2023-04-26 10:09 139  
[   ]com.tughi.aggregator.json2023-05-06 09:05 139  
[   ]de.live.gdev.cherrymusic.json2023-05-20 01:50 139  
[   ]de.rampro.activitydiary.json2023-05-19 23:28 139  
[   ]eu.bubu1.fdroidclassic.json2023-05-19 16:41 139  
[   ]godau.fynn.bandcampdirect.json2023-05-19 06:46 139  
[   ]in.sunilpaulmathew.ashell.json2023-06-05 08:07 139  
[   ]io.github.yoshi1123.adbio.json2023-05-18 21:57 139  
[   ]namlit.siteswapgenerator.json2023-06-05 04:09 139  
[   ]org.fedorahosted.freeotp.json2023-05-29 02:13 139  
[   ]org.freedombox.freedombox.json2023-05-23 19:22 139  
[   ]org.jellyfin.mobile.json2023-05-28 21:36 139  
[   ]org.joinmastodon.android.json2023-05-28 21:33 139  
[   ]org.sorz.lab.tinykeepass.json2023-05-22 15:56 139  
[   ]superustats.tool.android.json2023-06-03 06:46 139  
[   ]at.or.at.plugoffairplane.json2023-04-29 00:09 140  
[   ]com.dfa.hubzilla_android.json2023-06-05 09:06 140  
[   ]com.example.spokennumbers.json2023-04-28 00:39 140  
[   ]com.lightning.walletapp.json2023-04-27 05:42 140  
[   ]com.saha.batchuninstaller.json2023-04-26 11:57 140  
[   ]com.simondalvai.ball2box.json2023-05-27 08:36 140  
[   ]com.yassirh.digitalocean.json2023-04-25 21:07 140  
[   ]de.live.gdev.timetracker.json2023-05-20 01:50 140  
[   ]nl.implode.regenalarm.json2023-06-04 10:56 140  
[   ]org.billthefarmer.buses.json2023-06-04 07:52 140  
[   ]org.cimbar.camerafilecopy.json2023-05-29 04:12 140  
[   ]ru.glesik.wifireminders.json2023-05-22 01:39 140  
[   ]br.com.gualandi.dailypill.json2023-04-28 23:01 141  
[   ]com.akansh.fileserversuit.json2023-07-15 08:45 141  
[   ]com.bijoysingh.quicknote.json2021-03-10 13:04 141  
[   ]com.fr3ts0n.stagefever.json2023-04-27 22:11 141  
[   ]com.jtmcn.archwiki.viewer.json2023-04-27 08:35 141  
[   ]com.marcospoerl.simplypace.json2023-04-27 03:18 141  
[   ]com.matejdro.pebbledialer.json2023-04-27 02:53 141  
[   ]com.ml.proximitysensorfix.json2023-04-27 01:23 141  
[   ]de.ccc.events.badge.card10.json2023-05-20 06:43 141  
[   ]de.rki.covpass.checkapp.json2023-07-11 14:13 141  
[   ]hu.tagsoft.ttorrent.search.json2023-05-19 05:48 141  
[   ]org.bandev.buddhaquotes.json2023-06-04 07:55 141  
[   ]org.benoitharrault.sudoku.json2023-07-05 08:33 141  
[   ]org.pyload.android.client.json2023-05-28 06:40 141  
[   ]org.schabi.jedentageinset.json2023-06-02 07:13 141  
[   ]org.smc.inputmethod.indic.json2023-05-22 16:11 141  
[   ]tk.hack5.treblecheck.json2023-06-04 06:27 141  
[   ]app.librenews.io.librenews.json2023-04-29 01:36 142  
[   ]com.nikola.jakshic.dagger.json2023-04-26 20:56 142  
[   ]com.sigmarelax.doitoscihub.json2023-04-26 10:01 142  
[   ]com.xargsgrep.portknocker.json2023-04-25 21:23 142  
[   ]de.digisocken.anotherrss.json2023-05-20 04:14 142  
[   ]is.xyz.omw.json2023-05-18 16:58 142  
[   ]net.osmand.srtmPlugin.paid.json2023-06-04 19:18 142  
[   ]org.basketbuilddownloader.json2023-07-05 08:34 142  
[   ]org.emunix.unipatcher.json2022-03-19 16:11 142  
[   ]org.ligi.materialteatimer.json2023-05-23 12:45 142  
[   ]t20kdc.offlinepuzzlesolver.json2023-05-21 20:46 142  
[   ]com.adityakamble49.dcipher.json2021-03-10 17:21 143  
[   ]com.bikodbg.sharetopinboard.json2023-06-10 11:04 143  
[   ]com.example.muzei.muzeiapod.json2023-04-28 00:40 143  
[   ]com.ghostsq.commander.sftp.json2023-01-09 19:07 143  
[   ]com.ktprograms.watertracker.json2023-04-27 07:31 143  
[   ]com.nathaniel.motus.cavevin.json2023-04-27 00:12 143  
[   ]com.szchoiceway.aios.bridge.json2023-04-26 04:49 143  
[   ]com.tobykurien.google_news.json2023-04-26 03:25 143  
[   ]de.cloneapps.crypto_prices.json2023-05-20 06:19 143  
[   ]de.eknoes.inofficialgolem.json2023-05-20 03:45 143  
[   ]dev.bartuzen.qbitcontroller.json2023-05-19 19:53 143  
[   ]eu.veldsoft.hungarian.rings.json2023-05-19 14:31 143  
[   ]open.com.permissionsmanager.json2023-06-04 10:03 143  
[   ]org.andresoviedo.dddmodel2.json2023-06-04 09:16 143  
[   ]org.woheller69.audiometry.json2023-05-22 07:03 143  
[   ]ademar.bitac.json2023-04-29 01:56 144  
[   ]com.ahorcado.json2023-04-28 20:25 144  
[   ]com.gitlab.terrakok.gitfox.json2023-04-27 15:38 144  
[   ]com.nextcloud.client.json2023-04-26 23:54 144  
[   ]com.nononsenseapps.wanidoku.json2023-04-26 19:04 144  
[   ]eu.neilalexander.yggdrasil.json2023-05-27 08:07 144  
[   ]m.co.rh.id.a_personal_stuff.json2023-06-03 10:13 144  
[   ]org.cry.otp.json2023-05-15 19:12 144  
[   ]au.com.wallaceit.reddinator.json2023-04-28 23:30 145  
[   ]com.bernaferrari.sdkmonitor.json2023-06-09 12:44 145  
[   ]com.denytheflowerpot.scrunch.json2023-06-03 14:05 145  
[   ]com.gacode.relaunchx.json2023-04-27 21:46 145  
[   ]com.jeroen1602.lighthouse_pm.json2023-04-27 09:39 145  
[   ]com.lubenard.oring_reminder.json2023-04-27 04:46 145  
[   ]com.manuelvargastapia.libgen.json2023-04-27 03:24 145  
[   ]com.rohitsuratekar.NCBSinfo.json2023-04-26 12:01 145  
[   ]com.uploadedlobster.PwdHash.json2023-04-25 23:15 145  
[   ]de.qspool.clementineremote.json2023-07-15 07:33 145  
[   ]de.vier_bier.habpanelviewer.json2023-07-15 07:23 145  
[   ]org.musicpd.json2023-05-28 13:16 145  
[   ]org.simlar.json2023-05-22 16:21 145  
[   ]org.strawberryforum.argentum.json2023-05-22 13:37 145  
[   ]org.thiolliere.youtubestream.json2023-05-22 11:09 145  
[   ]org.xcsoar.json2023-05-22 06:06 145  
[   ]app.shosetsu.android.fdroid.json2023-06-05 11:33 146  
[   ]at.tacticaldevc.panictrigger.json2023-04-29 00:09 146  
[   ]be.ugent.zeus.hydra.open.json2023-06-05 11:30 146  
[   ]click.dummer.UartSmartwatch.json2023-05-26 17:27 146  
[   ]com.kanedias.holywarsoo.json2023-04-27 08:16 146  
[   ]com.marceljurtz.lifecounter.json2023-04-27 03:23 146  
[   ]com.thibaudperso.sonycamera.json2023-04-26 03:52 146  
[   ]com.tobykurien.webmediashare.json2023-04-26 03:21 146  
[   ]com.twoeightnine.root.xvii.json2023-04-26 00:24 146  
[   ]com.vonglasow.michael.qz.json2023-04-25 22:40 146  
[   ]me.austinhuang.instagrabber.json2023-06-05 07:59 146  
[   ]net.i2p.android.router.json2023-05-17 12:50 146  
[   ]org.bienvenidoainternet.app.json2023-05-16 21:01 146  
[   ]org.openintents.filemanager.json2023-05-28 10:28 146  
[   ]at.manuelbichler.octalsuntime.json2023-07-13 08:56 147  
[   ]ch.abertschi.waterme.water_me.json2023-05-27 10:27 147  
[   ]co.garmax.materialflashlight.json2023-05-25 14:12 147  
[   ]com.benarmstead.simplecooking.json2023-06-03 21:01 147  
[   ]com.flx_apps.digitaldetox.json2023-04-28 00:00 147  
[   ]com.github.ktsr42.rsyncserver.json2023-04-27 17:33 147  
[   ]com.github.moko256.twitlatte.json2023-06-03 11:10 147  
[   ]com.manimarank.websitemonitor.json2023-04-27 03:26 147  
[   ]com.noahjutz.splitfit.fdroid.json2023-04-26 20:13 147  
[   ]com.smartpack.kernelprofiler.json2023-04-26 07:57 147  
[   ]com.thirtydegreesray.openhub.json2023-04-26 03:51 147  
[   ]de.drmaxnix.birthdaycountdown.json2023-06-03 10:37 147  
[   ]eu.veldsoft.ithaka.board.game.json2023-05-19 14:30 147  
[   ]grmpl.mk.stepandheightcounter.json2023-05-19 06:27 147  
[   ]me.billdietrich.fake_contacts.json2023-06-10 09:03 147  
[   ]org.openintents.shopping.json2023-05-28 10:26 147  
[   ]x653.bullseye.json2023-06-03 06:30 147  
[   ]com.nhellfire.kerneladiutor.json2023-04-26 21:10 148  
[   ]de.hoffmannsgimmickstaupunkt.json2023-05-20 03:02 148  
[   ]de.vanitasvitae.enigmandroid.json2023-05-19 20:06 148  
[   ]godau.fynn.usagedirect.system.json2023-05-19 06:30 148  
[   ]mobi.maptrek.json2023-06-05 05:22 148  
[   ]org.kontalk.json2023-05-28 20:06 148  
[   ]org.mozilla.mozstumbler.json2023-05-28 13:26 148  
[   ]subreddit.android.appstore.json2023-06-03 06:47 148  
[   ]uk.co.richyhbm.monochromatic.json2023-06-03 06:35 148  
[   ]com.confinement.diconfinement.json2023-06-09 12:34 149  
[   ]com.correctsyntax.biblenotify.json2023-06-10 10:56 149  
[   ]com.dozingcatsoftware.kumquats.json2023-04-28 03:47 149  
[   ]com.github.muellerma.stopwatch.json2023-05-06 06:01 149  
[   ]com.michaeltroger.gruenerpass.json2023-04-27 02:01 149  
[   ]com.miloshpetrov.sol2.android.json2023-06-02 09:52 149  
[   ]com.nicolasbrailo.vlcfreemote.json2023-04-26 20:56 149  
[   ]com.simplemobiletools.launcher.json2023-05-12 05:53 149  
[   ]com.tomatodev.timerdroid.json2023-04-26 02:29 149  
[   ]com.trianguloy.clipboardeditor.json2023-05-06 09:05 149  
[   ]de.bulling.barcodebuddyscanner.json2023-05-20 06:47 149  
[   ]nl.eventinfra.wifisetup.json2023-07-05 08:42 149  
[   ]org.secuso.privacyfriendlydame.json2023-05-22 17:37 149  
[   ]phone.vishnu.dialogmusicplayer.json2023-05-22 05:11 149  
[   ]tech.platypush.platypush.json2023-06-01 20:11 149  
[   ]click.dummer.notify_to_jabber.json2023-05-25 14:13 150  
[   ]com.anddevw.getchromium.json2023-06-05 11:22 150  
[   ]com.fediphoto.json2023-04-28 00:15 150  
[   ]com.gmail.jiwopene.temperature.json2023-04-27 15:30 150  
[   ]de.tobiasbielefeld.brickgames.json2023-05-19 21:07 150  
[   ]io.github.project_travel_mate.json2022-02-05 05:14 150  
[   ]org.blokada.fem.fdroid.json2023-05-16 20:18 150  
[   ]org.noise_planet.noisecapture.json2023-06-03 08:10 150  
[   ]org.notabug.lifeuser.moviedb.json2023-05-28 12:58 150  
[   ]org.qosp.notes.json2023-05-28 06:40 150  
[   ]code.name.monkey.retromusic.json2023-05-25 14:12 151  
[   ]com.punksta.apps.volumecontrol.json2023-04-26 13:28 151  
[   ]com.zola.bmi.json2023-05-12 05:19 151  
[   ]community.fairphone.checkup.json2023-04-27 00:34 151  
[   ]in.blogspot.anselmbros.torchie.json2023-05-19 03:24 151  
[   ]io.github.z3r0c00l_2k.aquadroid.json2023-05-18 21:57 151  
[   ]org.fitchfamily.android.dejavu.json2023-05-29 02:13 151  
[   ]taco.apkmirror.json2023-06-01 20:15 151  
[   ]com.decred.decredaddressscanner.json2023-04-28 05:11 152  
[   ]fr.jnda.android.ipcalc.json2023-05-19 08:43 152  
[   ]in.amfoss.raag.json2023-05-19 03:57 152  
[   ]io.github.hidroh.materialistic.json2023-05-19 00:55 152  
[   ]link.standen.michael.fatesheets.json2023-05-18 10:16 152  
[   ]me.anon.grow.json2023-05-18 01:25 152  
[   ]net.christianbeier.droidvnc_ng.json2023-06-04 23:15 152  
[   ]org.pipoypipagames.towerjumper.json2023-05-28 07:34 152  
[   ]com.icebem.akt.json2023-05-27 08:55 153  
[   ]com.ominous.batterynotification.json2023-05-26 14:44 153  
[   ]dev.corruptedark.diditakemymeds.json2023-05-19 19:53 153  
[   ]dev.obfusk.jiten_webview.json2023-05-19 19:28 153  
[   ]it.danieleverducci.nextcloudmaps.json2023-05-18 16:29 153  
[   ]link.standen.michael.phonesaver.json2023-05-18 10:05 153  
[   ]net.stargw.fok.json2023-06-04 12:14 153  
[   ]om.sstvencoder.json2023-06-04 10:19 153  
[   ]org.getdisconnected.libreipsum.json2023-05-29 00:52 153  
[   ]xdsopl.robot36.json2023-06-01 17:35 153  
[   ]ca.rmen.android.scrumchatter.json2023-04-28 22:35 154  
[   ]ca.snoe.deedum.json2023-04-28 22:34 154  
[   ]ch.deletescape.lawnchair.plah.json2023-05-25 14:20 154  
[   ]com.github.webierta.call_counter.json2023-06-03 11:05 154  
[   ]com.jefftharris.passwdsafe.json2023-04-27 10:12 154  
[   ]com.jovial.jrpn.json2023-04-27 08:45 154  
[   ]com.orpheusdroid.screenrecorder.json2023-04-26 17:09 154  
[   ]com.zoffcc.applications.zanavi.json2023-05-12 05:37 154  
[   ]de.freifunk_karte.freifunk_karte.json2023-05-20 03:28 154  
[   ]fr.unix_experience.owncloud_sms.json2023-05-19 07:21 154  
[   ]info.guardianproject.pixelknot.json2023-05-19 03:05 154  
[   ]io.va.exposed.json2023-05-18 17:39 154  
[   ]org.astonbitecode.rustkeylock.json2023-06-04 08:40 154  
[   ]android.nachiketa.ebookdownloader.json2023-04-29 01:49 155  
[   ]com.tasomaniac.openwith.floss.json2023-04-26 04:13 155  
[   ]com.toxtox.philosopherstonewidget.json2023-04-26 02:21 155  
[   ]cz.jirkovsky.lukas.chmupocasi.json2023-05-11 22:27 155  
[   ]de.clemensbartz.android.launcher.json2023-05-20 06:19 155  
[   ]org.godotengine.editor.v4.json2023-06-04 06:44 155  
[   ]tech.waelk.radioactive.metronome.json2023-06-02 06:47 155  
[   ]wangdaye.com.geometricweather.json2023-06-03 06:32 155  
[   ]at.h4x.awhip.json2023-04-29 00:17 156  
[   ]com.bernaferrari.changedetection.json2023-06-03 20:56 156  
[   ]com.tjEnterprises.phase10Counter.json2023-05-26 12:11 156  
[   ]de.jepfa.bdt.json2023-06-05 08:18 156  
[   ]es.usc.citius.servando.calendula.json2022-02-05 21:12 156  
[   ]nl.viter.glider.json2023-06-04 10:48 156  
[   ]org.linphone.json2023-05-28 18:11 156  
[   ]org.scoutant.rpn.json2023-05-22 17:39 156  
[   ]org.surrel.facebooknotifications.json2023-05-22 12:58 156  
[   ]uk.co.yahoo.p1rpp.calendartrigger.json2023-06-03 06:35 156  
[   ]za.co.lukestonehm.logicaldefence.json2023-06-03 06:27 156  
[   ]ca.rmen.android.networkmonitor.json2023-04-28 22:36 157  
[   ]com.dosse.bwentrain.androidPlayer.json2023-06-03 13:20 157  
[   ]com.elsdoerfer.android.autostarts.json2023-06-09 12:20 157  
[   ]com.github.whyrising.flashyalarm.json2023-06-05 08:42 157  
[   ]com.jarsilio.android.waveup.tasker.json2023-04-27 10:12 157  
[   ]com.transway.caresteouvert.json2023-04-26 02:18 157  
[   ]de.markusfisch.android.screentime.json2023-05-27 08:17 157  
[   ]de.mm20.launcher2.release.json2023-07-15 07:40 157  
[   ]org.jdfossapps.android.shopwithmom.json2023-05-28 21:37 157  
[   ]org.microg.nlp.backend.ichnaea.json2023-05-23 08:28 157  
[   ]org.ogre.browser.json2023-05-28 12:44 157  
[   ]com.github.linwoodcloud.dev_doctor.json2023-04-27 17:26 158  
[   ]de.thecode.android.tazreader.json2023-05-19 21:30 158  
[   ]net.ddns.mlsoftlaberge.trycorder.json2023-07-05 09:07 158  
[   ]rodrigodavy.com.github.pixelartist.json2023-05-22 02:49 158  
[   ]com.brentpanther.bitcoincashwidget.json2023-06-05 10:22 159  
[   ]com.cointrend.json2023-06-05 09:14 159  
[   ]com.dosse.clock31.json2023-07-15 08:36 159  
[   ]com.dosse.dozeoff.json2023-06-05 08:57 159  
[   ]com.gmail.anubhavdas54.whatsdeleted.json2023-04-27 15:33 159  
[   ]com.gravityplay.json2023-04-27 14:56 159  
[   ]com.mbestavros.geometricweather.json2023-04-27 02:29 159  
[   ]com.readrops.app.json2023-04-26 12:39 159  
[   ]exe.bbllw8.anemo.json2023-06-28 09:30 159  
[   ]fr.mobdev.goblim.json2023-05-19 08:24 159  
[   ]io.infinyte7.ankiimageocclusion.json2023-05-18 18:36 159  
[   ]org.secuso.privacyfriendlysketching.json2023-05-22 17:11 159  
[   ]pl.edu.pjwstk.s999844.shoppinglist.json2023-05-22 04:48 159  
[   ]com.antoniotari.reactiveampacheapp.json2023-06-05 11:20 160  
[   ]com.chancehorizon.just24hoursplus.json2023-06-03 16:34 160  
[   ]com.dozingcatsoftware.vectorcamera.json2023-06-05 08:56 160  
[   ]de.baumann.thema.json2023-05-20 07:52 160  
[   ]de.spiritcroc.defaultdarktheme_oms.json2023-05-19 22:54 160  
[   ]info.metadude.android.clt.schedule.json2023-05-19 03:02 160  
[   ]info.varden.hauk.json2023-05-19 02:27 160  
[   ]net.artificialworlds.rabbitescape.json2023-06-04 23:38 160  
[   ]net.osmand.plus.json2023-07-05 08:58 160  
[   ]org.proninyaroslav.blink_comparison.json2023-05-26 07:22 160  
[   ]com.joshuacerdenia.android.nicefeed.json2023-04-27 08:45 161  
[   ]com.leinardi.ubuntucountdownwidget.json2023-04-27 06:27 161  
[   ]com.razeeman.util.simpletimetracker.json2023-06-03 10:50 161  
[   ]com.therealbluepandabear.pixapencil.json2023-06-02 01:39 161  
[   ]net.justdave.nwsweatheralertswidget.json2023-06-04 22:06 161  
[   ]org.principate.matthew.dealing_sheet.json2023-07-04 06:42 161  
[   ]at.h4x.metaapp.json2023-04-29 00:16 162  
[   ]com.anysoftkeyboard.languagepack.neo.json2023-06-05 11:19 162  
[   ]com.github.doomsdayrs.apps.shosetsu.json2023-04-27 18:09 162  
[   ]com.stoptheballs.json2023-04-26 05:11 162  
[   ]com.tortel.syslog.json2023-04-26 02:25 162  
[   ]io.github.subhamtyagi.privacyapplock.json2023-05-18 22:51 162  
[   ]org.microg.nlp.backend.nominatim.json2023-05-23 08:24 162  
[   ]org.sufficientlysecure.localcalendar.json2023-05-22 13:04 162  
[   ]ca.rmen.nounours.json2023-04-28 22:26 163  
[   ]ch.bubendorf.locusaddon.gsakdatabase.json2023-05-06 06:16 163  
[   ]fr.covidat.android.json2023-05-19 13:41 163  
[   ]io.spaceapi.community.myhackerspace.json2023-06-03 10:15 163  
[   ]org.liberty.android.fantastischmemo.json2023-05-28 19:43 163  
[   ]org.pgnapps.pk2.json2023-05-28 07:42 163  
[   ]org.secuso.privacyfriendlyminesweeper.json2023-05-22 17:31 163  
[   ]org.secuso.privacyfriendlywifimanager.json2023-05-22 16:55 163  
[   ]com.plexer0.nitter.json2023-06-05 08:33 164  
[   ]de.c3nav.droid.json2023-05-20 06:43 164  
[   ]de.hirtenstrasse.michael.lnkshortener.json2023-05-20 03:05 164  
[   ]org.herrlado.ask.languagepack.czech.json2023-05-23 16:36 164  
[   ]ch.blinkenlights.android.vanillaplug.json2023-05-27 10:25 165  
[   ]com.adonai.manman.json2023-06-04 02:29 165  
[   ]com.angrydoughnuts.android.alarmclock.json2023-06-10 11:14 165  
[   ]com.dosse.speedtest.json2023-06-07 09:05 165  
[   ]io.github.subhamtyagi.quickcalculation.json2023-06-03 10:16 165  
[   ]jp.takke.datastats.json2023-05-18 12:18 165  
[   ]kaba.yucata.envoy.json2023-05-18 12:01 165  
[   ]mono.hg.json2023-06-05 05:00 165  
[   ]org.jitsi.meet.json2023-05-28 21:34 165  
[   ]org.pixeldroid.app.json2023-05-28 07:27 165  
[   ]ru.gelin.android.weather.notification.json2023-05-22 02:06 165  
[   ]subins2000.manglish.json2023-06-03 06:47 165  
[   ]co.prestosole.clima.json2023-05-12 05:11 166  
[   ]com.jstappdev.identify_dog_breeds_pro.json2023-06-03 11:01 166  
[   ]com.paranoiaworks.unicus.android.sse.json2023-04-26 16:13 166  
[   ]deep.ryd.rydplayer.json2023-05-20 03:44 166  
[   ]ga.testapp.testapp.json2023-05-19 07:15 166  
[   ]org.pocketworkstation.pckeyboard.json2023-05-28 07:22 166  
[   ]org.secuso.privacyfriendlyyahtzeedicer.json2023-05-22 16:54 166  
[   ]com.lolo.io.onelist.json2023-04-27 04:57 167  
[   ]io.github.tjg1.nori.json2023-05-18 22:49 167  
[   ]org.brightdv.boxbox.json2023-06-04 06:48 167  
[   ]org.kaqui.json2023-05-28 21:32 167  
[   ]org.kknickkk.spider.json2023-05-28 20:15 167  
[   ]com.anysoftkeyboard.languagepack.dutch.json2023-06-10 11:13 168  
[   ]com.better.alarm.json2023-06-09 12:43 168  
[   ]com.danhasting.radar.json2023-06-05 09:09 168  
[   ]com.jstappdev.dbclf.json2023-04-27 08:40 168  
[   ]com.marcdonald.hibi.json2023-04-27 03:21 168  
[   ]com.nazmar.dicegainz.json2023-04-27 00:06 168  
[   ]com.nighthawkapps.wallet.android.json2023-04-26 21:06 168  
[   ]com.sadellie.unitto.json2023-04-26 11:57 168  
[   ]com.vlille.checker.json2023-04-25 22:41 168  
[   ]de.selfnet.wifisetup.json2023-07-15 07:31 168  
[   ]info.tangential.task.json2023-05-19 02:29 168  
[   ]marto.rtl_tcp_andro.json2023-05-18 09:45 168  
[   ]net.guildem.publicip.json2023-07-01 21:25 168  
[   ]org.dystopia.email.json2023-05-29 03:07 168  
[   ]org.galexander.sshd.json2023-05-29 01:08 168  
[   ]org.sipdroid.sipua.json2023-05-22 16:12 168  
[   ]xyz.deepdaikon.quinb.json2023-06-03 06:30 168  
[   ]com.arnaud.metronome.json2023-06-09 12:52 169  
[   ]net.xisberto.timerpx.json2023-06-04 11:02 169  
[   ]org.atalk.android.json2023-06-04 08:33 169  
[   ]org.phramusca.jamuz.json2023-06-03 07:12 169  
[   ]top.donmor.tiddloid.json2023-06-03 06:39 169  
[   ]com.anysoftkeyboard.languagepack.basque.json2023-06-04 00:41 170  
[   ]com.anysoftkeyboard.languagepack.greek.json2023-06-05 11:19 170  
[   ]com.aefyr.sai.fdroid.json2023-06-09 12:58 171  
[   ]com.cyb3rko.flashdim.json2023-06-03 15:14 171  
[   ]com.gianlu.aria2app.json2023-04-27 20:34 171  
[   ]com.oF2pks.chairlock.json2023-04-26 17:55 171  
[   ]com.trisven.safenotes.json2023-06-05 08:26 171  
[   ]fr.nihilus.music.json2023-05-19 08:19 171  
[   ]it.vfsfitvnm.vimusic.json2023-06-02 09:10 171  
[   ]net.pfiers.osmfocus.json2023-06-04 13:35 171  
[   ]nl.mpcjanssen.simpletask.nextcloud.json2023-06-04 10:48 171  
[   ]one.librem.mail.json2022-03-20 00:57 171  
[   ]org.secuso.privacyfriendlycircuittraining.json2023-05-22 17:37 171  
[   ]org.woheller69.arity.json2023-06-04 06:32 171  
[   ]oss.krtirtho.spotube.json2023-05-28 06:33 171  
[   ]be.mygod.vpnhotspot.json2021-04-02 08:27 172  
[   ]com.anysoftkeyboard.languagepack.danish.json2023-06-09 12:54 172  
[   ]com.anysoftkeyboard.languagepack.german.json2023-06-07 09:35 172  
[   ]com.anysoftkeyboard.languagepack.hebrew.json2023-06-04 00:40 172  
[   ]com.cgogolin.library.json2023-06-05 09:21 172  
[   ]com.enrico.earthquake.batterysimplysolid.json2023-06-09 12:19 172  
[   ]com.freerdp.afreerdp.json2023-04-27 22:11 172  
[   ]com.github.shadowsocks.plugin.v2ray.json2023-06-03 11:06 172  
[   ]com.serwylo.babyphone.json2023-04-26 10:35 172  
[   ]es.wolfi.app.passman.json2023-05-19 16:51 172  
[   ]foss.cnugteren.nlweer.json2023-05-19 14:00 172  
[   ]net.gcompris.full.json2023-06-04 22:52 172  
[   ]org.petero.droidfish.json2023-05-28 07:40 172  
[   ]ca.cmetcalfe.xposed.disablebatterywarnings.json2023-04-28 22:41 173  
[   ]com.fr3ts0n.androbd.plugin.gpsprovider.json2023-04-27 22:19 173  
[   ]timur.webcall.callee.json2023-07-05 07:57 173  
[   ]app.crescentcash.src.json2023-04-29 01:48 174  
[   ]com.anysoftkeyboard.languagepack.italian.json2023-06-04 00:39 174  
[   ]com.anysoftkeyboard.languagepack.latvian.json2023-06-04 00:39 174  
[   ]com.cweb.messenger.json2023-06-10 10:55 174  
[   ]com.freshollie.monkeyboard.keystoneradio.json2023-04-27 22:06 174  
[   ]com.iakmds.librecamera.json2023-05-31 07:33 174  
[   ]com.in.my.district.json2023-04-27 12:15 174  
[   ]com.knirirr.beecount.json2023-07-10 13:12 174  
[   ]com.vadimfrolov.duorem.json2023-04-25 23:11 174  
[   ]de.devmil.muzei.bingimageofthedayartsource.json2023-05-20 04:39 174  
[   ]de.nulide.bikecomputer.json2023-05-20 00:07 174  
[   ]dev.linwood.butterfly.json2023-05-19 19:41 174  
[   ]godau.fynn.usagedirect.json2023-05-19 06:28 174  
[   ]it.danieleverducci.ojo.json2023-05-18 16:03 174  
[   ]org.transdroid.search.json2023-05-22 09:16 174  
[   ]us.spotco.ir_remote.json2023-06-03 06:34 174  
[   ]de.simplestatswidget.json2023-07-15 07:31 175  
[   ]es.ideotec.workouttime.json2023-05-19 16:56 175  
[   ]org.ea.sqrl.json2023-05-29 03:05 175  
[   ]quickly.quit.json2023-05-22 03:01 175  
[   ]streetwalrus.usbmountr.json2023-06-03 06:47 175  
[   ]com.anysoftkeyboard.languagepack.russian2.json2023-06-04 00:37 176  
[   ]com.drnoob.datamonitor.json2023-06-05 08:55 176  
[   ]com.ruesga.android.wallpapers.photophase.json2023-04-26 11:59 176  
[   ]org.broeuschmeul.android.gps.usb.provider.json2023-06-04 06:49 176  
[   ]aq.metallists.loudbang.json2023-04-29 00:59 177  
[   ]com.abhijitvalluri.android.fitnotifications.json2023-06-05 11:26 177  
[   ]com.anysoftkeyboard.languagepack.hungarian.json2023-06-05 11:19 177  
[   ]com.cyb3rko.pincredible.json2023-07-15 08:38 177  
[   ]com.damiengo.websiterss.json2023-06-03 14:51 177  
[   ]com.darshancomputing.BatteryIndicatorPro.json2023-06-07 09:11 177  
[   ]com.iatfei.streakalarm.json2023-04-27 13:19 177  
[   ]de.varengold.activeTAN.json2023-07-15 07:24 177  
[   ]eu.roggstar.luigithehunter.batterycalibrate.json2023-05-19 14:56 177  
[   ]net.basov.omn.fdroid.json2023-06-04 23:35 177  
[   ]ogz.tripeaks.json2023-06-04 10:34 177  
[   ]org.andstatus.game2048.json2023-06-04 08:54 177  
[   ]org.mfri.bbcworldservicenewshourdownloader.json2023-05-23 08:42 177  
[   ]org.snikket.android.json2023-05-22 16:00 177  
[   ]ac.robinson.mediaphone.json2023-04-29 01:58 178  
[   ]com.anysoftkeyboard.languagepack.brazilian.json2023-06-08 12:18 178  
[   ]com.anysoftkeyboard.languagepack.norwegian.json2023-06-07 09:34 178  
[   ]com.calcitem.sanmill.json2023-06-05 09:31 178  
[   ]com.launcher.silverfish.json2023-04-27 06:49 178  
[   ]fr.witchdoctors.c4ffein.oosfirmwareextractor.json2023-05-19 07:21 178  
[   ]godau.fynn.moodledirect.json2023-06-03 10:23 178  
[   ]info.schnatterer.nusic.json2023-05-19 02:40 178  
[   ]org.keyoxide.keyoxide.json2023-05-28 20:18 178  
[   ]org.metabrainz.android.json2023-05-28 16:05 178  
[   ]org.sajeg.fallingblocks.json2023-06-03 07:01 178  
[   ]se.leap.bitmaskclient.json2023-06-03 06:50 178  
[   ]simple.reboot.com.json2023-05-21 23:43 178  
[   ]com.fr3ts0n.androbd.plugin.sensorprovider.json2023-04-27 22:18 179  
[   ]com.servoz.appsdisabler.json2023-04-26 10:35 179  
[   ]com.tananaev.calculator.json2023-04-26 04:19 179  
[   ]com.anysoftkeyboard.languagepack.portuguese.json2023-06-04 00:38 180  
[   ]com.example.deeplviewer.json2023-04-28 00:54 180  
[   ]com.gianlu.aria2android.json2023-04-27 20:37 180  
[   ]com.pilot51.voicenotify.json2023-04-26 15:10 180  
[   ]com.shkmishra.lyrically.json2023-04-26 10:02 180  
[   ]inc.flide.vi8.json2023-05-19 03:24 180  
[   ]io.github.sds100.keymapper.inputmethod.latin.json2023-05-18 23:17 180  
[   ]krillefear.funwithkanji.json2023-12-14 10:16 180  
[   ]org.osmdroid.json2023-05-28 08:30 180  
[   ]org.woheller69.solxpect.json2023-06-04 06:32 180  
[   ]player.efis.data.pan.arg.json2023-05-22 04:55 180  
[   ]rocks.poopjournal.flashy.json2023-05-22 02:58 180  
[   ]com.fox2code.mmm.fdroid.json2023-07-15 08:34 181  
[   ]com.oml.recordtimedroid.json2023-04-26 17:32 181  
[   ]com.vladrip.drgassistant.json2023-07-18 08:13 181  
[   ]cz.lastaapps.menza.json2023-07-10 09:02 181  
[   ]fr.mobdev.blooddonation.json2023-05-19 08:23 181  
[   ]io.github.lufte.lona.json2023-05-19 00:08 181  
[   ]org.indywidualni.fblite.json2023-05-28 22:05 181  
[   ]ua.bossly.tools.translit.json2023-06-03 06:37 181  
[   ]cloud.valetudo.companion.json2023-05-26 17:27 182  
[   ]com.stoutner.privacycell.json2023-04-26 05:03 182  
[   ]com.torrents_csv_android.json2023-06-03 10:44 182  
[   ]name.seguri.android.lock.json2023-07-05 09:12 182  
[   ]com.atr.tedit.json2023-06-05 11:15 183  
[   ]com.bytestemplar.tonedef.json2023-06-05 09:28 183  
[   ]com.mcsnowflake.worktimer.json2023-04-27 02:29 183  
[   ]com.sanzoghenzo.markdownr.json2023-06-02 01:43 183  
[   ]com.sleeptimer.json2023-04-26 07:57 183  
[   ]com.unicornsonlsd.finamp.json2023-04-25 23:15 183  
[   ]de.hampager.dapnetmobile.json2023-05-20 03:16 183  
[   ]de.nproth.pin.json2023-07-14 07:51 183  
[   ]yetzio.yetcalc.json2023-06-02 06:27 183  
[   ]com.abhinavmarwaha.wrotto.json2023-04-28 20:37 184  
[   ]com.securefilemanager.app.json2023-04-26 10:38 184  
[   ]com.svenjacobs.app.leon.json2023-04-26 04:59 184  
[   ]com.vecturagames.android.app.passwordgenerator.json2023-04-25 23:09 184  
[   ]de.datlag.burningseries.json2023-07-13 08:00 184  
[   ]org.billthefarmer.print.json2023-07-05 08:30 184  
[   ]xyz.zedler.patrick.grocy.json2023-06-01 17:10 184  
[   ]com.yakovlevegor.DroidRec.json2023-06-03 10:41 185  
[   ]ru.seva.finder.json2023-05-22 01:21 185  
[   ]com.ivanovsky.passnotes.json2023-06-02 10:00 186  
[   ]com.sduduzog.slimlauncher.json2023-04-26 11:17 186  
[   ]com.zfdang.zsmth_android.json2023-06-03 10:41 186  
[   ]fr.smarquis.sleeptimer.json2023-05-19 07:36 186  
[   ]me.zhanghai.android.files.json2023-06-05 05:59 186  
[   ]anupam.acrylic.json2023-04-29 01:49 187  
[   ]com.commit451.gitlab.json2023-06-05 09:14 187  
[   ]com.ferrarid.converterpro.json2023-04-28 00:15 187  
[   ]com.lavadip.miniVector.json2023-07-10 12:24 187  
[   ]com.quaap.bookymcbookface.json2023-04-26 13:22 187  
[   ]com.sanskritbasics.memory.json2023-04-26 11:27 187  
[   ]com.vwp.owmap.json2023-04-25 22:26 187  
[   ]dev.atajan.lingva_android.json2023-07-15 07:24 187  
[   ]in.shick.diode.json2023-05-19 02:16 187  
[   ]net.reichholf.dreamdroid.json2023-06-04 13:21 187  
[   ]net.sourceforge.x11basic.json2023-06-04 12:15 187  
[   ]org.billthefarmer.specie.json2023-06-04 07:27 187  
[   ]org.docspell.docspellshare.json2023-05-29 03:30 187  
[   ]com.concept1tech.instalate.json2023-06-10 10:57 188  
[   ]com.timenotclocks.bookcase.json2023-04-26 03:48 188  
[   ]pro.rudloff.openvegemap.json2023-05-22 03:20 188  
[   ]ch.protonvpn.android.json2023-07-10 17:41 189  
[   ]com.akdev.nofbeventscraper.json2023-06-05 11:24 189  
[   ]com.alaory.wallmewallpaper.json2023-06-05 11:24 189  
[   ]com.example.barcodescanner.json2023-04-28 00:54 189  
[   ]com.infomaniak.drive.json2023-04-27 12:33 189  
[   ]de.hosenhasser.funktrainer.json2023-05-20 03:01 189  
[   ]espero.jiofibatterynotifier.json2023-05-19 16:51 189  
[   ]m.co.rh.id.a_news_provider.json2023-05-18 01:34 189  
[   ]net.nitratine.priceperunit.json2023-06-04 20:27 189  
[   ]ohi.andre.consolelauncher.json2023-06-04 10:34 189  
[   ]org.jellyfin.androidtv.json2023-05-23 15:20 189  
[   ]software.mdev.bookstracker.json2023-06-04 06:28 189  
[   ]theredspy15.ltecleanerfoss.json2023-06-03 06:40 189  
[   ]com.lijukay.quotesAltDesign.json2023-07-15 08:15 190  
[   ]es.eoinrul.ecwt.json2023-05-19 16:59 190  
[   ]eu.pretix.pretixscan.droid.json2023-05-19 15:19 190  
[   ]fr.fdesousa.bikesharinghub.json2023-05-19 12:43 190  
[   ]me.wenxinwang.pulsedroidrtp.json2023-06-24 10:34 190  
[   ]de.saschahlusiak.freebloks.json2023-07-15 07:32 191  
[   ]nl.implode.weer.json2023-07-05 08:42 191  
[   ]com.lithium.leona.openstud.json2023-04-27 05:15 192  
[   ]com.machiav3lli.derdiedas.json2023-04-27 04:12 192  
[   ]com.mschlauch.comfortreader.json2023-04-27 00:36 192  
[   ]com.practicalapps.hamtrainer.json2023-04-26 13:30 192  
[   ]com.smartpack.scriptmanager.json2023-04-26 07:56 192  
[   ]com.tananaev.passportreader.json2023-04-26 04:15 192  
[   ]com.vitorpamplona.amethyst.json2023-06-02 01:36 192  
[   ]de.sudoq.json2023-05-19 22:06 192  
[   ]dev.patrickgold.florisboard.json2023-05-19 19:20 192  
[   ]org.sensors2.osc.json2024-05-15 11:57 192  
[   ]org.sufficientlysecure.ical.json2023-05-22 13:26 192  
[   ]ru.sash0k.bluetooth_terminal.json2023-05-22 01:21 192  
[   ]com.cliffracertech.soundaura.json2023-06-05 09:20 193  
[   ]com.github.shadowsocks.json2023-07-13 08:32 193  
[   ]de.wikilab.android.ldapsync.json2023-05-19 18:38 193  
[   ]info.guardianproject.ripple.json2023-05-19 03:04 194  
[   ]site.leos.setter.json2023-05-21 22:53 194  
[   ]ch.famoser.mensa.json2023-05-27 10:25 195  
[   ]com.aaronjwood.portauthority.json2023-05-27 10:20 195  
[   ]com.aurora.adroid.json2023-06-05 11:15 195  
[   ]com.dp.logcatapp.json2023-06-05 08:55 195  
[   ]com.emanuelef.remote_capture.json2023-06-05 08:52 195  
[   ]com.eurokonverter.json2023-06-05 08:51 195  
[   ]com.gianlu.pretendyourexyzzy.json2023-04-27 20:32 195  
[   ]com.haringeymobile.ukweather.json2023-04-27 13:54 195  
[   ]com.philolog.hoplitekeyboard.json2023-04-26 15:22 195  
[   ]com.sesu8642.infusion_timer.json2023-04-26 10:18 195  
[   ]com.termux.tasker.json2023-04-26 03:59 195  
[   ]de.drhoffmannsoftware.calcvac.json2023-05-20 04:12 195  
[   ]de.mw136.tonuino.json2023-05-20 00:12 195  
[   ]org.olpc_france.sugarizer.json2023-05-28 12:40 195  
[   ]posidon.launcher.json2023-05-22 03:33 195  
[   ]com.mde.potdroid.json2023-04-27 02:29 196  
[   ]com.slash.batterychargelimit.json2023-04-26 08:01 196  
[   ]com.sweak.qralarm.json2023-06-05 08:28 196  
[   ]de.tobiasbielefeld.solitaire.json2023-05-19 21:07 196  
[   ]luke.launcher.json2023-05-18 09:47 196  
[   ]souch.smp.json2023-06-03 06:47 197  
[   ]com.maxfour.music.json2023-04-27 02:36 198  
[   ]de.antonarnold.android.xoverrideheadphonejackdetection.json2023-05-11 20:13 198  
[   ]de.micmun.android.deufeitage.json2023-07-15 07:40 198  
[   ]de.sorunome.unifiednlp.trains.json2023-06-02 09:28 198  
[   ]me.ranko.autodark.json2023-06-05 06:21 198  
[   ]uk.sensoryunderload.infinilist.json2023-06-03 06:34 198  
[   ]com.dosse.chromiumautoupdater.json2023-06-05 08:57 199  
[   ]com.github.axet.tonegenerator.json2023-04-27 18:50 199  
[   ]com.mareksebera.simpledilbert.json2023-04-27 03:17 199  
[   ]com.termux.widget.json2023-04-26 03:59 199  
[   ]com.termux.window.json2023-04-26 03:56 199  
[   ]de.smasi.tickmate.json2023-07-14 07:45 199  
[   ]foundation.e.blisslauncher.json2023-05-19 14:00 199  
[   ]io.github.chiver.json2023-05-19 01:48 199  
[   ]org.libreoffice.impressremote.json2023-05-28 19:38 199  
[   ]org.ttrssreader.json2023-05-22 09:06 199  
[   ]protect.rentalcalc.json2023-05-22 03:06 199  
[   ]org.hwyl.sexytopo.json2023-05-28 22:19 200  
[   ]rocks.poopjournal.vacationdays.json2023-05-22 02:57 200  
[   ]ru.meefik.busybox.json2023-05-22 01:29 200  
[   ]com.gabm.screenrotationcontrol.json2023-04-27 21:51 201  
[   ]com.google.android.stardroid.json2023-04-27 15:04 201  
[   ]com.jerboa.json2023-04-27 09:39 201  
[   ]org.btcmap.json2023-06-04 06:47 201  
[   ]org.mattvchandler.a2050.json2023-05-28 16:17 201  
[   ]org.mosad.seil0.projectlaogai.json2023-05-28 15:22 201  
[   ]org.secuso.privacyfriendlydicer.json2023-05-22 17:35 201  
[   ]com.example.hochi.nextcompanion.json2023-04-28 00:41 202  
[   ]com.github.quarck.calnotify.json2023-05-31 08:11 202  
[   ]com.github.shadowsocks.tv.json2023-06-03 11:05 202  
[   ]com.kunzisoft.keyboard.switcher.json2023-04-27 07:18 202  
[   ]de.jbservices.nc_passwords_app.json2023-05-20 02:56 202  
[   ]eu.depau.etchdroid.json2023-05-19 16:39 202  
[   ]com.bobek.metronome.json2023-07-12 08:45 203  
[   ]com.simplemobiletools.calendar.json2023-04-26 09:59 203  
[   ]com.termux.json2023-04-26 04:02 203  
[   ]de.monocles.browser.json2023-07-15 07:40 203  
[   ]es.ideotec.t16fling.json2023-05-19 16:56 203  
[   ]nl.tsmeets.todotree.json2023-07-17 05:08 203  
[   ]org.liberty.android.freeotpplus.json2023-05-28 19:42 203  
[   ]com.aaronhalbert.nosurfforreddit.json2023-05-26 17:25 204  
[   ]com.podverse.fdroid.json2023-04-26 14:21 204  
[   ]de.wuapps.moredays.json2023-05-19 18:36 204  
[   ]org.secuso.privacyfriendlymemory.json2023-05-22 17:31 204  
[   ]org.stingle.photos.json2023-05-22 13:48 204  
[   ]com.vonglasow.michael.satstat.json2023-04-25 22:39 205  
[   ]de.k3b.android.locationMapViewer.json2023-07-15 07:45 205  
[   ]menion.android.whereyougo.json2023-06-05 06:28 205  
[   ]im.fdx.v2ex.json2023-05-19 05:12 206  
[   ]luke.kfz.json2023-05-18 09:49 206  
[   ]org.fitchfamily.android.symphony.json2023-05-29 02:11 206  
[   ]com.cosmos.unreddit.json2023-06-10 10:56 207  
[   ]com.oF2pks.adbungfu.json2023-04-26 17:56 207  
[   ]io.github.domi04151309.powerapp.json2023-05-19 01:28 207  
[   ]io.github.froodyapp.json2023-05-19 01:16 207  
[   ]io.github.muntashirakon.Music.json2023-05-18 23:23 207  
[   ]org.asnelt.derandom.json2023-06-04 08:44 207  
[   ]ca.rmen.android.frenchcalendar.json2023-04-28 22:36 208  
[   ]com.quinncasey.paperless_share.json2023-04-26 13:15 208  
[   ]com.rehanced.lunary.json2023-04-26 12:36 208  
[   ]de.moooon.acrylicons.json2023-07-15 07:38 208  
[   ]me.kuehle.carreport.json2023-06-17 16:37 208  
[   ]org.gittner.osmbugs.json2023-05-29 00:51 208  
[   ]troop.com.freedcam.json2023-06-03 06:38 208  
[   ]com.github.cetoolbox.json2023-04-27 18:19 209  
[   ]com.zeapo.pwdstore.json2023-04-25 21:01 209  
[   ]com.dozingcatsoftware.mouse_pounce.json2023-06-06 10:40 210  
[   ]com.rubenwardy.minetestmodmanager.json2023-01-08 10:23 210  
[   ]com.tserumula.dbcleanerforwhatsapp.json2023-06-05 08:26 210  
[   ]de.koelle.christian.trickytripper.json2023-05-20 02:11 210  
[   ]com.ichi2.anki.json2023-04-27 13:16 211  
[   ]com.palliser.nztides.json2023-04-26 16:18 211  
[   ]de.fff.ccgt.json2023-05-20 03:43 211  
[   ]dev.msfjarvis.aps.json2023-05-19 19:28 211  
[   ]io.github.benoitduffez.cupsprint.json2023-05-19 02:05 211  
[   ]net.taler.merchantpos.json2023-06-04 12:03 211  
[   ]org.woheller69.level.json2023-05-22 06:52 211  
[   ]se.oandell.riksdagen.json2022-04-01 15:52 211  
[   ]us.spotco.extirpater.json2023-06-03 06:34 211  
[   ]com.picross.nonocross.json2023-04-26 15:19 212  
[   ]fr.cph.chicago.foss.json2022-02-05 16:37 212  
[   ]godau.fynn.dsbdirect.json2023-05-19 06:43 212  
[   ]nl.devluuk.sleepywifi.json2023-06-04 10:56 212  
[   ]swati4star.createpdf.json2023-06-01 20:50 212  
[   ]com.dozingcatsoftware.cardswithcats.json2023-06-05 08:56 213  
[   ]com.fr3ts0n.androbd.plugin.mqtt.json2023-04-27 22:19 213  
[   ]com.martinmimigames.tinymusicplayer.json2023-05-27 08:46 213  
[   ]de.markusfisch.android.pielauncher.json2023-07-15 07:42 213  
[   ]net.blumia.pineapple.lockscreen.oss.json2023-06-04 23:15 213  
[   ]org.adaway.json2023-06-04 09:39 213  
[   ]ru.henridellal.dialer.json2023-05-22 01:39 213  
[   ]de.kromke.andreas.opus1musicplayer.json2023-05-20 02:01 214  
[   ]at.jclehner.rxdroid.json2023-04-29 00:14 215  
[   ]com.danefinlay.ttsutil.json2023-06-03 14:51 215  
[   ]com.dimtion.shaarlier.json2023-06-05 09:04 215  
[   ]com.saverio.pdfviewer.json2023-04-26 11:18 215  
[   ]com.vladpen.cams.json2023-06-03 10:42 215  
[   ]eu.darken.capod.json2023-07-15 07:19 215  
[   ]com.farmerbb.notepad.json2023-04-28 00:26 216  
[   ]com.ghstudios.android.mhgendatabase.json2023-04-27 20:39 216  
[   ]com.pcinpact.json2023-04-26 16:03 216  
[   ]de.baumann.pdfcreator.json2023-05-11 19:15 216  
[   ]de.kaffeemitkoffein.feinstaubwidget.json2023-05-20 02:14 216  
[   ]edu.berkeley.boinc.json2023-05-26 08:53 216  
[   ]fr.guillaumevillena.opendnsupdater.json2023-05-19 08:54 216  
[   ]io.github.domi04151309.batterytool.json2023-05-19 01:28 216  
[   ]kasun.sinhala.keyboard.json2023-05-18 12:01 216  
[   ]net.frju.flym.json2023-06-04 22:53 216  
[   ]net.nullsum.audinaut.json2023-06-04 20:27 216  
[   ]org.amoradi.syncopoli.json2023-06-04 09:19 216  
[   ]org.lumicall.android.json2023-05-28 16:41 216  
[   ]org.secuso.privacyfriendlynetmonitor.json2023-05-22 17:24 216  
[   ]com.ds.avare.json2023-06-05 08:54 217  
[   ]com.hardcodecoder.pulsemusic.json2023-04-27 14:01 217  
[   ]com.menny.android.anysoftkeyboard.json2023-04-27 02:06 217  
[   ]com.perol.asdpl.play.pixivez.libre.json2023-04-26 15:44 217  
[   ]io.trezor.app.json2023-05-18 17:43 217  
[   ]at.bitfire.nophonespam.json2023-04-29 00:18 218  
[   ]com.github.tmo1.sms_ie.json2023-06-03 11:05 218  
[   ]pro.kherel.selfprivacy.json2023-05-22 03:21 218  
[   ]com.markuspage.android.atimetracker.json2023-04-27 03:14 219  
[   ]de.micmun.android.nextcloudcookbook.json2023-05-20 01:20 219  
[   ]org.midorinext.android.json2023-05-28 15:38 219  
[   ]org.secuso.privacyfriendlyfoodtracker.json2023-05-22 17:34 219  
[   ]app.fyreplace.client.json2023-04-29 01:39 220  
[   ]com.LAPARCELA.nihonoari.json2023-07-10 12:31 220  
[   ]com.blogspot.e_kanivets.moneytracker.json2023-06-05 11:06 220  
[   ]com.porg.gugal.json2023-07-14 08:21 220  
[   ]info.metadude.android.divoc.schedule.json2023-05-19 02:53 220  
[   ]me.zeeroooo.materialfb.json2023-06-23 09:47 220  
[   ]org.mariotaku.twidere.json2023-05-28 16:27 220  
[   ]tech.projectmatris.antimalwareapp.json2023-06-03 06:41 220  
[   ]com.apk.editor.json2023-06-10 11:12 221  
[   ]com.enjoyingfoss.feeel.json2023-06-03 11:47 221  
[   ]com.starry.myne.json2023-07-14 08:14 221  
[   ]foehnix.widget.json2023-05-19 14:00 221  
[   ]io.heckel.ntfy.json2023-05-18 21:25 221  
[   ]org.musicbrainz.picard.barcodescanner.json2023-05-28 13:16 221  
[   ]su.xash.husky.json2023-06-03 06:45 221  
[   ]us.spotco.maps.json2023-06-03 06:33 221  
[   ]de.quaddyservices.dynamicnightlight.json2023-07-15 07:33 222  
[   ]org.droidtr.deletegapps.json2023-05-29 03:20 222  
[   ]org.dslul.openboard.inputmethod.latin.json2023-05-29 03:16 222  
[   ]org.krita.json2023-05-28 19:47 222  
[   ]au.id.micolous.farebot.json2023-04-28 23:30 223  
[   ]com.apozas.contactdiary.json2023-06-05 11:18 223  
[   ]com.indieweb.indigenous.json2023-04-27 13:00 223  
[   ]com.katiearose.sobriety.json2023-06-03 10:58 223  
[   ]com.machiav3lli.fdroid.json2023-06-03 10:55 223  
[   ]com.tuntori.mightieramp.json2023-04-26 02:08 223  
[   ]de.audioattack.openlink.json2023-05-11 20:05 223  
[   ]de.niendo.ImapNotes3.json2023-06-03 10:33 223  
[   ]gov.anzong.androidnga.json2023-06-05 08:08 223  
[   ]org.alberto97.ouilookup.json2023-06-04 09:33 223  
[   ]org.daylightingsociety.wherearetheeyes.json2023-05-15 19:09 223  
[   ]player.efis.data.sah.jap.json2023-05-22 04:55 223  
[   ]player.efis.data.usa.can.json2023-05-22 04:53 223  
[   ]player.efis.data.zar.aus.json2023-05-22 04:52 223  
[   ]slowscript.warpinator.json2023-06-03 06:48 223  
[   ]app.fedilab.nitterizeme.json2023-04-29 01:45 224  
[   ]com.movim.movim.json2023-04-27 00:41 225  
[   ]fi.kroon.vadret.json2023-05-19 14:02 225  
[   ]liou.rayyuan.ebooksearchtaiwan.json2023-05-27 07:56 225  
[   ]net.inbox.pager.json2023-06-04 22:26 225  
[   ]com.reminimalism.materialslivewallpaper.json2023-04-26 12:22 226  
[   ]de.sesu8642.feudaltactics.json2023-06-02 09:28 227  
[   ]eu.lepiller.nani.json2023-05-19 15:47 227  
[   ]com.bald.uriah.baldphone.json2023-06-05 11:10 228  
[   ]com.noahjutz.gymroutines.json2023-04-26 20:32 228  
[   ]org.kiwix.kiwixmobile.json2023-02-16 08:33 228  
[   ]org.secuso.privacyfriendlyfinancemanager.json2023-05-22 17:34 228  
[   ]ch.corten.aha.worldclock.json2023-05-27 10:25 229  
[   ]com.anysoftkeyboard.languagepack.spain.json2023-06-04 00:37 229  
[   ]com.genonbeta.TrebleShot.json2023-04-27 21:21 229  
[   ]jp.redmine.redmineclient.json2023-05-18 12:20 229  
[   ]org.schabi.newpipelegacy.json2023-05-22 17:55 229  
[   ]com.bnyro.trivia.json2023-06-05 11:05 230  
[   ]com.manimarank.spell4wiki.json2023-07-10 09:26 230  
[   ]net.ivpn.client.json2023-07-05 07:07 230  
[   ]ca.cmetcalfe.locationshare.json2023-04-28 22:54 231  
[   ]com.iven.iconify.json2023-04-27 10:32 231  
[   ]com.kabouzeid.gramophone.json2021-03-13 12:58 231  
[   ]com.plusonelabs.calendar.json2023-04-26 14:22 231  
[   ]com.rascarlo.arch.packages.json2023-04-26 12:49 231  
[   ]de.moekadu.tuner.json2023-07-15 07:40 231  
[   ]de.syss.MifareClassicTool.json2023-07-15 07:28 231  
[   ]jp.ddo.hotmist.unicodepad.json2023-05-18 12:28 231  
[   ]network.mysterium.vpn.json2023-06-04 11:01 231  
[   ]org.andstatus.todoagenda.json2023-07-05 08:36 231  
[   ]org.epstudios.morbidmeter.json2023-05-29 02:45 231  
[   ]org.telegram.messenger.json2023-06-03 06:59 231  
[   ]org.woheller69.lavatories.json2023-05-22 07:01 231  
[   ]org.zerodogg.migraineLog.json2023-05-22 05:15 231  
[   ]xyz.zedler.patrick.doodle.json2023-06-03 06:27 231  
[   ]com.tomer.screenshotsharer.json2023-04-26 02:28 232  
[   ]org.billthefarmer.solver.json2023-07-05 08:29 232  
[   ]org.traffxml.roadeagle.json2023-05-22 09:34 232  
[   ]com.governikus.ausweisapp2.json2023-04-27 15:02 233  
[   ]ch.admin.bag.covidcertificate.wallet.json2023-05-25 14:22 234  
[   ]com.ebaschiera.triplecamel.json2023-06-03 12:25 234  
[   ]org.ghostsinthelab.apps.guilelessbopomofo.json2023-05-29 00:51 234  
[   ]tech.ula.json2023-06-02 06:48 234  
[   ]cn.ac.lz233.tarnhelm.json2023-06-05 11:27 235  
[   ]com.maltaisn.notes.sync.json2023-04-27 03:38 235  
[   ]com.orgzly.json2023-04-26 17:18 235  
[   ]com.smartpack.smartflasher.json2023-04-26 07:56 235  
[   ]de.eidottermihi.raspicheck.json2023-05-20 03:45 235  
[   ]fr.odrevet.bide_et_musique.json2023-05-19 07:53 235  
[   ]info.spotcomms.wlanbackend.json2023-06-03 10:22 235  
[   ]io.github.zyrouge.symphony.json2023-05-31 06:57 235  
[   ]net.mabako.steamgifts.json2023-06-04 21:15 235  
[   ]org.totschnig.ocr.tesseract.json2023-05-22 09:43 235  
[   ]tranquvis.simplesmsremote.json2023-06-03 06:38 235  
[   ]com.kanedias.vanilla.lyrics.json2023-04-27 08:06 236  
[   ]com.simplemobiletools.draw.json2023-04-26 09:37 236  
[   ]com.yogeshpaliyal.keypass.json2023-04-25 21:06 236  
[   ]org.oxycblt.auxio.json2023-05-28 07:59 236  
[   ]com.termux.nix.json2023-04-26 04:00 237  
[   ]org.mbach.lemonde.json2023-05-28 16:16 237  
[   ]org.woheller69.audio_analyzer_for_android.json2023-07-11 06:39 237  
[   ]info.metadude.android.datenspuren.schedule.json2023-05-19 02:53 238  
[   ]app.fedilab.nitterizemelite.json2023-04-29 01:43 239  
[   ]com.MarcosDiez.shareviahttp.json2023-04-27 03:18 239  
[   ]com.github.vauvenal5.yaga.json2023-06-02 10:04 239  
[   ]com.polar.nextcloudservices.json2023-04-26 14:16 239  
[   ]com.todobom.opennotescanner.json2023-04-26 03:11 239  
[   ]de.chagemann.regexcrossword.json2023-05-20 06:40 239  
[   ]eu.uwot.fabio.altcoinprices.json2023-05-19 14:38 239  
[   ]fr.xgouchet.packageexplorer.json2023-05-19 07:15 239  
[   ]io.kuenzler.whatsappwebtogo.json2023-05-18 18:34 239  
[   ]net.nhiroki.bluelineconsole.json2023-05-17 10:09 239  
[   ]org.woheller69.TimeLapseCam.json2023-07-15 06:36 239  
[   ]ru.ra66it.updaterforspotify.json2023-05-22 01:21 239  
[   ]be.casperverswijvelt.unifiedinternetqs.json2023-07-10 18:09 240  
[   ]ch.admin.bag.covidcertificate.verifier.json2023-04-28 22:16 240  
[   ]com.simplemobiletools.notes.json2023-04-26 09:08 240  
[   ]io.github.quillpad.json2023-06-05 08:02 240  
[   ]org.deluge.trireme.json2023-05-15 18:43 240  
[   ]org.voidsink.anewjkuapp.json2023-05-22 07:51 240  
[   ]com.app.missednotificationsreminder.json2023-06-05 11:18 241  
[   ]com.kmac5dev.mindfulnotifier.json2023-12-15 08:39 241  
[   ]com.planes.android.json2023-04-26 14:45 241  
[   ]org.asafonov.monly.json2023-06-04 08:49 241  
[   ]co.appreactor.news.json2023-05-27 10:20 242  
[   ]com.fmsys.snapdrop.json2023-04-27 23:59 242  
[   ]fr.nuage.souvenirs.json2023-05-19 08:12 242  
[   ]org.kore.kolabnotes.android.json2023-05-28 19:54 242  
[   ]com.blockbasti.justanotherworkouttimer.json2023-06-10 11:03 243  
[   ]me.hackerchick.raisetoanswer.json2023-05-18 00:08 243  
[   ]org.walleth.json2023-05-22 07:41 243  
[   ]community.peers.internetradio.json2023-04-27 00:32 244  
[   ]io.github.domi04151309.home.json2023-05-19 01:28 244  
[   ]com.tananaev.logcat.json2023-12-15 01:10 245  
[   ]de.tu_chemnitz.wlan.json2023-05-19 21:04 245  
[   ]org.jak_linux.dns66.json2023-05-28 21:37 245  
[   ]com.asdoi.timetable.json2023-06-05 11:16 246  
[   ]com.github.yeriomin.yalpstore.json2023-04-27 15:42 246  
[   ]com.krawieck.lemmur.json2023-04-27 07:31 246  
[   ]com.looker.droidify.json2023-07-10 09:51 246  
[   ]com.oF2pks.kalturadeviceinfos.json2023-04-26 17:44 246  
[   ]com.sapuseven.untis.json2023-04-26 11:26 246  
[   ]org.mosad.teapod.json2023-05-28 15:20 246  
[   ]protect.budgetwatch.json2023-05-22 03:13 246  
[   ]com.gh4a.json2023-04-27 20:48 247  
[   ]net.mypapit.mobile.myposition.json2023-06-04 20:31 247  
[   ]com.newsblur.json2023-04-26 23:49 249  
[   ]in.sunilpaulmathew.izzyondroid.json2023-06-05 08:07 249  
[   ]me.ash.reader.json2023-12-14 09:30 249  
[   ]me.murks.filmchecker.json2023-06-05 06:28 249  
[   ]com.github.ruleant.getback_gps.json2023-06-03 11:06 251  
[   ]com.maxistar.textpad.json2023-04-27 02:35 251  
[   ]com.nathanatos.Cuppa.json2023-04-27 00:12 251  
[   ]com.simplemobiletools.keyboard.json2023-05-06 05:47 251  
[   ]com.ultramegatech.ey.json2023-04-25 23:36 251  
[   ]de.jepfa.personaltasklogger.json2023-06-02 09:32 251  
[   ]de.wellenvogel.bonjourbrowser.json2023-05-19 19:15 251  
[   ]design.codeux.authpass.fdroid.json2023-05-19 23:03 251  
[   ]io.github.muntashirakon.setedit.json2023-05-18 23:20 251  
[   ]me.impa.knockonports.json2023-06-05 06:51 251  
[   ]rasel.lunar.launcher.json2023-06-02 07:04 251  
[   ]us.spotco.motionlock.json2023-06-03 06:33 251  
[   ]com.simplemobiletools.gallery.json2023-04-26 09:32 252  
[   ]de.k3b.android.androFotoFinder.json2023-07-14 08:01 252  
[   ]de.kromke.andreas.mediascanner.json2023-07-17 13:39 252  
[   ]io.github.chronosx88.yggdrasil.json2023-05-19 02:00 252  
[   ]com.asksven.betterbatterystats.json2023-06-09 12:51 253  
[   ]hr.kravarscan.enchantedfortress.json2023-05-19 05:49 253  
[   ]net.dcnnt.json2023-07-03 07:09 254  
[   ]com.invoiceninja.app.json2023-04-27 10:49 255  
[   ]de.k3b.android.intentintercept.json2023-07-18 08:04 255  
[   ]dev.corruptedark.openchaoschess.json2023-05-19 19:52 255  
[   ]es.esy.CosyDVR.json2023-05-19 16:58 255  
[   ]org.bitbucket.watashi564.combapp.json2023-06-04 07:16 255  
[   ]com.averi.worldscribe.json2023-06-05 11:14 256  
[   ]com.farmerbb.secondscreen.free.json2023-04-28 00:23 256  
[   ]com.kazufukurou.nanji.json2023-07-10 13:28 256  
[   ]de.k3b.android.lossless_jpg_crop.json2023-07-14 08:01 256  
[   ]email.schaal.ocreader.json2023-05-19 17:00 256  
[   ]fr.jnda.android.flashalert.json2023-05-19 08:43 256  
[   ]org.encointer.wallet.json2023-05-29 02:47 256  
[   ]xyz.myachin.downloader.json2023-06-03 06:28 256  
[   ]de.tutao.tutanota.json2023-07-15 07:25 257  
[   ]org.tengel.planisphere.json2023-05-22 11:23 257  
[   ]com.amaze.filemanager.json2023-06-09 12:57 258  
[   ]tool.fff.profilepicturegenerator.json2023-06-03 06:39 258  
[   ]com.poupa.attestationdeplacement.json2023-04-26 14:00 259  
[   ]io.github.domi04151309.alwayson.json2023-05-19 01:28 259  
[   ]io.vertretungsplan.client.android.json2023-05-18 17:36 259  
[   ]me.hackerchick.sharetoinputstick.json2023-06-14 17:28 259  
[   ]xyz.deepdaikon.xeonjia.json2023-06-03 06:29 259  
[   ]mobi.omegacentauri.SendReduced.json2023-06-23 09:46 260  
[   ]com.aistra.hail.json2023-06-05 11:25 261  
[   ]com.gsnathan.pdfviewer.json2023-04-27 14:54 261  
[   ]com.jairaj.janglegmail.motioneye.json2023-12-15 11:24 261  
[   ]com.rtbishop.look4sat.json2023-04-26 12:00 261  
[   ]com.wangdaye.mysplash.json2021-03-08 22:50 261  
[   ]com.wireguard.android.json2023-04-14 13:45 261  
[   ]cz.dvratil.fbeventsync.json2023-05-11 22:37 261  
[   ]eu.quelltext.mundraub.json2023-05-19 14:56 261  
[   ]io.ente.photos.fdroid.json2023-05-23 22:38 261  
[   ]org.catrobat.paintroid.json2023-05-15 20:44 261  
[   ]org.dicio.dicio_android.json2023-05-29 04:04 261  
[   ]player.efis.cfd.json2023-05-22 05:10 261  
[   ]tech.bogomolov.incomingsmsgateway.json2023-06-03 06:41 261  
[   ]com.benny.openlauncher.json2023-06-08 12:09 262  
[   ]com.chessclock.android.json2023-06-03 16:31 262  
[   ]de.freehamburger.json2023-05-20 03:33 262  
[   ]de.schildbach.wallet.json2023-07-12 07:28 262  
[   ]org.courville.nova.json2023-05-15 20:00 262  
[   ]org.fox.tttrss.json2023-05-29 01:57 262  
[   ]com.github.siggel.coordinatejoker.json2023-06-03 11:05 263  
[   ]com.jkuester.unlauncher.json2023-04-27 09:35 263  
[   ]com.luk.saucenao.json2023-04-27 04:38 264  
[   ]org.exarhteam.iitc_mobile.json2023-07-16 08:27 264  
[   ]com.antony.muzei.pixiv.json2023-06-06 11:14 266  
[   ]com.greenaddress.abcore.json2023-04-27 14:55 266  
[   ]com.moez.QKSMS.json2023-12-15 07:31 266  
[   ]com.serwylo.babydots.json2023-04-26 10:35 266  
[   ]org.unifiedpush.example.json2023-05-22 08:39 266  
[   ]player.efis.data.eur.rus.json2023-05-22 04:56 266  
[   ]click.dummer.textthing.json2023-05-24 08:36 267  
[   ]com.minar.birday.json2023-04-27 01:55 267  
[   ]eu.sum7.conversations.json2023-05-19 14:38 267  
[   ]nitezh.ministock.json2023-12-14 06:59 267  
[   ]rocks.poopjournal.todont.json2023-05-22 02:57 267  
[   ]app.simple.inure.json2023-06-02 10:35 268  
[   ]com.tachibana.downloader.json2023-04-26 04:50 268  
[   ]de.kromke.andreas.cameradatefolders.json2023-06-05 08:17 268  
[   ]info.metadude.android.rc3.schedule.json2023-05-19 02:42 268  
[   ]me.kavishhukmani.watwitchstickers.json2023-06-05 06:45 268  
[   ]com.bobek.compass.json2023-06-10 11:03 269  
[   ]moe.dic1911.urlsanitizer.json2023-06-24 10:32 269  
[   ]org.ligi.survivalmanual.json2023-05-28 18:34 269  
[   ]co.timsmart.vouchervault.json2023-05-12 05:08 271  
[   ]com.ominous.quickweather.json2023-04-26 17:32 271  
[   ]com.oriondev.moneywallet.json2023-04-26 17:10 271  
[   ]io.github.subhamtyagi.openinwhatsapp.json2023-05-18 22:51 271  
[   ]org.bitbatzen.wlanscanner.json2023-12-14 06:22 271  
[   ]org.fitchfamily.android.gsmlocation.json2023-05-29 02:11 271  
[   ]org.kde.bettercounter.json2023-05-28 21:30 271  
[   ]org.nonononoki.hendroid.json2023-02-06 14:41 271  
[   ]io.github.muntashirakon.AppManager.json2023-05-18 23:53 272  
[   ]org.woheller69.omweather.json2023-06-04 06:32 272  
[   ]ro.radioromaniaactualitati.podcasts.json2023-07-15 06:33 272  
[   ]com.dosse.airpods.json2023-06-09 12:23 273  
[   ]com.waist.line.json2023-04-25 22:22 273  
[   ]de.beowulf.wetter.json2023-05-20 07:26 273  
[   ]eu.faircode.xlua.json2023-05-19 16:29 273  
[   ]io.github.subhamtyagi.ocr.json2023-05-18 23:02 273  
[   ]de.jepfa.yapm.json2023-07-15 07:46 274  
[   ]android.jonas.fakestandby.json2023-04-29 01:49 275  
[   ]com.crazylegend.vigilante.json2023-06-10 10:55 275  
[   ]com.drhoffmannstoolsdataloggerreader.json2023-06-05 08:55 275  
[   ]itkach.aard2.json2023-05-18 15:39 275  
[   ]be.ppareit.swiftp_free.json2023-04-28 23:20 276  
[   ]com.nltechno.dolidroidpro.json2023-04-26 20:32 276  
[   ]com.trianguloy.urlchecker.json2023-05-12 05:50 276  
[   ]me.rosuh.easywatermark.json2023-06-24 10:35 276  
[   ]com.ensoft.imgurviewer.json2023-06-03 11:39 277  
[   ]org.billthefarmer.gurgle.json2023-06-04 07:38 277  
[   ]xyz.myachin.saveto.json2023-06-03 06:27 277  
[   ]com.github.cythara.json2023-04-27 18:17 278  
[   ]com.gianlu.dnshero.json2023-04-27 20:32 279  
[   ]com.termux.styling.json2023-04-26 03:59 279  
[   ]net.moasdawiki.app.json2023-07-03 06:58 279  
[   ]nl.mpcjanssen.simpletask.webdav.json2023-06-04 10:48 279  
[   ]com.github.fi3te.notificationcron.json2023-04-27 17:58 280  
[   ]info.metadude.android.fosdem.schedule.json2023-05-19 02:49 280  
[   ]org.gnu.icecat.json2023-05-28 23:59 280  
[   ]threads.thor.json2023-06-03 06:40 280  
[   ]eu.faircode.email.json2023-05-19 16:37 281  
[   ]fr.gouv.android.stopcovid.json2023-05-19 12:04 281  
[   ]org.woheller69.spritpreise.json2023-05-27 06:38 281  
[   ]cz.vitskalicky.lepsirozvrh.json2023-05-11 22:16 282  
[   ]org.tessoft.qonvert.json2023-07-16 06:40 282  
[   ]de.westnordost.streetcomplete.expert.json2023-05-19 18:41 283  
[   ]ua.gardenapple.itchupdater.json2023-06-03 06:37 283  
[   ]de.yaacc.json2023-05-19 18:10 284  
[   ]at.linuxtage.companion.json2023-04-29 00:14 285  
[   ]com.bytehamster.flowitgame.json2023-06-05 10:01 285  
[   ]com.madlonkay.orgro.json2023-07-10 09:28 285  
[   ]com.manichord.mgit.json2023-04-27 03:30 285  
[   ]com.oF2pks.applicationsinfo.json2023-04-26 17:55 285  
[   ]com.omgodse.notally.json2023-04-26 17:32 285  
[   ]org.connectbot.json2023-05-15 20:26 285  
[   ]org.lufebe16.pysolfc.json2023-05-28 18:34 285  
[   ]ryey.easer.beta.json2023-05-22 00:39 285  
[   ]com.github.axet.bookreader.json2023-04-27 19:38 286  
[   ]com.llamacorp.equate.json2023-07-10 10:27 286  
[   ]com.superproductivity.superproductivity.json2023-04-26 05:00 286  
[   ]ee.ioc.phon.android.speak.json2023-05-19 17:03 286  
[   ]de.rwth_aachen.phyphox.json2023-05-19 23:20 287  
[   ]de.schildbach.wallet_test.json2023-05-19 23:07 287  
[   ]eu.roggstar.luigithehunter.dsaassistent.json2023-05-19 14:54 287  
[   ]org.decsync.cc.json2023-05-15 18:47 287  
[   ]com.github.mueller_ma.viewandroidversion.json2023-06-03 11:08 288  
[   ]com.daemon.ssh.json2023-06-10 10:55 289  
[   ]com.unciv.app.json2023-04-25 23:34 289  
[   ]me.murks.feedwatcher.json2023-06-22 07:40 290  
[   ]org.gdroid.gdroid.json2023-05-29 00:59 290  
[   ]agrigolo.chubbyclick.json2023-04-29 01:51 291  
[   ]com.activitymanager.json2023-06-04 02:32 291  
[   ]com.darshancomputing.BatteryIndicator.json2023-06-05 09:08 291  
[   ]com.dozingcatsoftware.bouncy.json2023-06-10 10:47 291  
[   ]com.jarsilio.android.drowser.json2023-04-27 10:21 291  
[   ]de.baumann.hhsmoodle.json2023-05-11 19:15 291  
[   ]de.markusfisch.android.libra.json2023-05-20 01:38 291  
[   ]io.github.lonamiwebs.klooni.json2023-05-19 00:45 291  
[   ]org.hollowbamboo.chordreader2.json2023-12-03 20:59 291  
[   ]com.android.keepass.json2023-06-08 12:19 292  
[   ]com.samebits.beacon.locator.json2023-04-26 11:32 292  
[   ]net.mullvad.mullvadvpn.json2023-06-04 20:46 292  
[   ]org.emunix.insteadlauncher.json2023-05-29 02:49 292  
[   ]org.projectmaxs.main.json2023-05-28 07:04 292  
[   ]org.transdroid.full.json2023-05-22 09:26 292  
[   ]felixwiemuth.simplereminder.json2023-05-19 14:11 293  
[   ]org.secuso.privacyfriendlyactivitytracker.json2023-05-22 17:38 294  
[   ]com.starry.greenstash.json2023-07-15 08:01 295  
[   ]xyz.deepdaikon.zoysii.json2023-06-03 06:29 295  
[   ]com.biglybt.android.client.json2021-03-13 11:20 296  
[   ]com.dev.xavier.tempusromanum.json2023-06-05 09:06 296  
[   ]com.jens.automation2.json2023-04-27 09:42 296  
[   ]com.jonjomckay.fritter.json2023-04-27 09:00 296  
[   ]com.kanedias.vanilla.audiotag.json2023-07-10 14:01 296  
[   ]com.sunilpaulmathew.debloater.json2023-04-26 05:02 296  
[   ]de.jl.notificationlog.json2023-05-20 02:31 296  
[   ]dev.linwood.butterfly.nightly.json2023-05-19 19:41 296  
[   ]juloo.keyboard2.json2023-05-18 12:12 296  
[   ]com.easyfitness.json2023-06-10 10:44 297  
[   ]de.jkliemann.parkendd.json2023-07-12 07:50 297  
[   ]dev.leonlatsch.photok.json2023-07-14 07:37 297  
[   ]it.rignanese.leo.slimfacebook.json2022-02-05 00:21 297  
[   ]org.ligi.passandroid.json2023-05-28 18:55 297  
[   ]rocks.tbog.tblauncher.json2023-05-22 02:48 297  
[   ]de.herrmann_engel.rbv.json2023-05-20 03:09 298  
[   ]la.daube.photochiotte.json2023-05-18 10:56 298  
[   ]net.minetest.minetest.json2023-06-04 21:10 298  
[   ]net.sourceforge.solitaire_cg.json2023-06-04 12:19 298  
[   ]org.mfri.bbcworldservicepodcastdownloader.json2023-07-16 06:49 299  
[   ]org.nuntius35.wrongpinshutdown.json2023-05-28 12:55 299  
[   ]org.secuso.privacyfriendlypasswordgenerator.json2023-05-22 17:15 299  
[   ]org.sw24softwares.starkeverben.json2023-05-22 12:57 299  
[   ]com.ktprograms.ohmsnow.json2023-07-10 13:02 300  
[   ]com.yubico.yubioath.json2023-04-25 21:01 300  
[   ]de.qwerty287.ftpclient.json2023-07-13 07:42 300  
[   ]nl.yoerinijs.notebuddy.json2023-06-28 07:19 300  
[   ]com.github.axet.binauralbeats.json2023-04-27 19:40 301  
[   ]com.github.axet.mover.json2023-04-27 19:04 301  
[   ]com.oasisfeng.island.fdroid.json2023-04-26 18:05 301  
[   ]com.sunilpaulmathew.translator.json2023-04-26 05:01 301  
[   ]de.szalkowski.activitylauncher.json2023-07-15 07:28 301  
[   ]org.softeg.slartus.forpdaplus.json2022-03-18 07:54 301  
[   ]br.com.colman.petals.json2023-04-28 23:03 302  
[   ]com.dkanada.gramophone.json2023-06-05 09:02 302  
[   ]com.nextcloud_cookbook_flutter.json2023-04-26 23:07 302  
[   ]de.freewarepoint.whohasmystuff.json2023-05-20 03:29 302  
[   ]com.github.ashutoshgngwr.tenbitclockwidget.json2023-04-27 19:51 303  
[   ]com.inspiredandroid.linuxcommandbibliotheca.json2023-07-10 15:15 303  
[   ]com.parishod.watomatic.json2023-04-26 16:09 303  
[   ]de.ritscher.simplemobiletools.contacts.pro.json2023-06-03 10:31 303  
[   ]org.mozilla.klar.json2023-06-04 06:38 303  
[   ]com.kanedias.vanilla.coverfetch.json2023-04-27 08:07 304  
[   ]com.mkulesh.onpc.json2023-04-27 01:30 304  
[   ]org.videolan.vlc.json2023-05-22 08:10 304  
[   ]de.metager.metagerapp.fdroid.json2023-05-20 01:20 306  
[   ]dev.patri9ck.a2ln.json2023-05-19 19:27 308  
[   ]org.secuso.privacyfriendlysudoku.json2023-05-22 17:09 308  
[   ]com.blacksquircle.ui.json2023-06-09 12:42 309  
[   ]com.github.postapczuk.lalauncher.json2023-05-31 08:33 309  
[   ]com.redcoracle.episodes.json2023-04-26 12:37 309  
[   ]de.markusfisch.android.wavelines.json2023-05-20 01:35 309  
[   ]name.gdr.acastus_photon.json2023-06-05 04:17 309  
[   ]org.dmfs.tasks.json2023-05-29 03:31 309  
[   ]com.yacgroup.yacguide.json2023-04-25 21:19 310  
[   ]de.benibela.videlibri.json2023-06-03 10:39 310  
[   ]de.tap.easy_xkcd.json2023-05-19 21:34 310  
[   ]libvirt-debian-bullseye-vagrant-amd64-official-20221010-1.box.sig2022-10-10 11:56 310  
[   ]net.eneiluj.moneybuster.json2023-06-04 23:10 310  
[   ]net.eneiluj.nextcloud.phonetrack.json2023-06-04 23:04 310  
[   ]net.kourlas.voipms_sms.json2023-06-04 21:55 310  
[   ]virtualbox-debian-bullseye-vagrant-amd64-official-20221010-1.box.sig2022-10-10 11:59 310  
[   ]com.asdoi.gymwen.json2023-06-05 11:17 311  
[   ]de.nulide.shiftcal.json2023-07-12 07:35 313  
[   ]de.spiritcroc.darkcroc.substratum.json2023-05-19 22:56 313  
[   ]kiwi.root.an2linuxclient.json2023-05-18 12:01 313  
[   ]me.mudkip.moememos.json2023-06-05 06:33 314  
[   ]com.amrdeveloper.linkhub.json2023-06-05 11:22 315  
[   ]com.faltenreich.diaguard.json2023-04-28 00:26 315  
[   ]com.kolloware.hypezigapp.json2023-04-27 07:40 315  
[   ]com.machiav3lli.backup.json2023-04-27 04:23 315  
[   ]net.redwarp.gifwallpaper.json2023-07-04 07:32 315  
[   ]org.xbmc.kore.json2023-05-22 06:05 315  
[   ]net.gaast.giggity.json2023-06-04 22:53 316  
[   ]org.secuso.privacyfriendlytodolist.json2023-05-22 17:06 316  
[   ]org.y20k.trackbook.json2023-05-22 05:50 316  
[   ]com.minar.randomix.json2023-04-27 01:44 317  
[   ]com.dar.nclientv2.json2023-06-05 09:08 318  
[   ]de.blinkt.openvpn.json2023-05-21 08:12 318  
[   ]com.vincentengelsoftware.vesandroidimagecompare.json2023-07-15 07:55 319  
[   ]io.github.subhamtyagi.lastlauncher.json2023-05-18 23:11 320  
[   ]com.bytehamster.changelog.json2023-06-05 10:02 321  
[   ]com.sunilpaulmathew.snotz.json2023-04-26 05:02 321  
[   ]dev.datlag.burningseries.json2023-06-05 08:13 321  
[   ]exa.lnx.a.json2023-05-19 14:25 321  
[   ]org.billthefarmer.gridle.json2023-07-17 04:53 322  
[   ]org.projectmaxs.module.nfc.json2023-05-28 06:56 322  
[   ]com.klee.sapio.json2023-07-13 08:22 323  
[   ]com.termux.api.json2023-04-26 04:01 323  
[   ]de.msal.muzei.nationalgeographic.json2023-05-20 00:15 323  
[   ]app.alextran.immich.json2023-07-14 09:21 324  
[   ]com.mikifus.padland.json2023-04-27 02:01 324  
[   ]com.perflyst.twire.json2023-04-26 15:24 324  
[   ]com.jarsilio.android.autoautorotate.json2023-04-27 10:23 326  
[   ]dummydomain.yetanothercallblocker.json2023-05-19 17:29 327  
[   ]info.plateaukao.einkbro.json2023-05-19 02:40 327  
[   ]io.github.sds100.keymapper.json2023-05-18 23:11 327  
[   ]org.freenetproject.mobile.json2023-12-03 21:15 327  
[   ]org.projectmaxs.module.misc.json2023-05-28 06:57 327  
[   ]org.woheller69.gpscockpit.json2023-05-22 07:01 327  
[   ]com.serwylo.beatgame.json2023-04-26 10:32 329  
[   ]org.isoron.uhabits.json2023-05-28 21:50 329  
[   ]com.github.libretube.json2023-06-05 08:47 331  
[   ]org.droidtr.keyboard.json2023-05-29 03:20 331  
[   ]su.sadrobot.yashlang.json2023-06-03 06:45 331  
[   ]org.gateshipone.malp.json2023-05-29 01:08 332  
[   ]org.projectmaxs.module.shell.json2023-05-28 06:53 332  
[   ]com.martinmimigames.littlemusicplayer.json2023-05-27 08:46 334  
[   ]fr.ubordeaux.math.paridroid.json2023-05-19 07:33 334  
[   ]com.github.livingwithhippos.unchained.json2023-06-02 02:03 337  
[   ]com.rascarlo.aurdroid.json2023-04-26 12:46 337  
[   ]de.chaosdorf.meteroid.json2023-05-20 06:39 338  
[   ]top.fumiama.copymanga.json2023-12-03 12:57 338  
[   ]com.farmerbb.taskbar.json2023-04-28 00:19 339  
[   ]com.smartpack.kernelmanager.json2023-04-26 07:57 339  
[   ]name.boyle.chris.sgtpuzzles.json2023-06-23 09:44 339  
[   ]org.ostrya.presencepublisher.json2023-05-28 08:05 339  
[   ]uk.co.busydoingnothing.prevo.json2023-06-03 06:35 339  
[   ]website.leifs.delta.foss.json2023-07-16 06:26 339  
[   ]com.zorinos.zorin_connect.json2023-05-12 05:16 340  
[   ]me.echeung.moemoekyun.fdroid.json2023-06-05 07:02 342  
[   ]org.projectmaxs.module.smsread.json2023-05-28 06:52 342  
[   ]org.projectmaxs.module.smssend.json2023-05-28 06:51 342  
[   ]org.projectmaxs.transport.xmpp.json2023-05-26 07:22 342  
[   ]com.nicobrailo.pianoli.json2023-04-26 21:06 344  
[   ]de.nulide.findmydevice.json2023-07-14 07:51 344  
[   ]com.nononsenseapps.notepad.json2023-04-26 19:01 345  
[   ]com.pierreduchemin.smsforward.json2023-04-26 15:18 345  
[   ]org.blokada.alarm.json2023-07-05 08:26 345  
[   ]org.disroot.disrootapp.json2023-05-29 03:33 345  
[   ]org.openpetfoodfacts.scanner.json2023-05-28 08:56 345  
[   ]org.schabi.nxbookmarks.json2023-05-22 17:48 345  
[   ]de.storchp.opentracks.osmplugin.offline.json2023-07-12 07:25 346  
[   ]org.projectmaxs.module.alarmset.json2023-05-28 07:03 347  
[   ]org.projectmaxs.module.fileread.json2023-05-28 06:59 347  
[   ]org.projectmaxs.module.smswrite.json2023-05-28 06:50 347  
[   ]pc.javier.seguime.json2023-05-22 05:11 347  
[   ]rocks.poopjournal.morse.json2023-05-22 02:58 347  
[   ]openfoodfacts.github.scrachx.openbeauty.json2023-07-04 07:15 350  
[   ]app.reading.stoic.stoicreading.json2023-04-29 01:28 351  
[   ]com.adguard.android.contentblocker.json2023-06-10 11:17 351  
[   ]com.stypox.mastercom_workbook.json2023-04-26 05:03 351  
[   ]de.hauke_stieler.geonotes.json2023-05-20 03:16 351  
[   ]com.oF2pks.jquarks.json2023-04-26 17:53 352  
[   ]org.projectmaxs.module.bluetooth.json2023-05-28 07:02 352  
[   ]org.projectmaxs.module.clipboard.json2023-05-28 07:01 352  
[   ]org.projectmaxs.module.filewrite.json2023-05-28 06:59 352  
[   ]org.projectmaxs.module.smsnotify.json2023-05-28 06:53 352  
[   ]org.woheller69.eggtimer.json2023-05-22 07:03 352  
[   ]org.y20k.escapepod.json2023-05-22 05:53 355  
[   ]de.storchp.opentracks.osmplugin.json2023-05-19 22:45 356  
[   ]cityfreqs.com.pilfershushjammer.json2023-05-25 14:13 357  
[   ]de.j4velin.wifiAutoOff.json2023-07-15 07:48 357  
[   ]de.thefeiter.liedgutverzeichnis.json2023-05-19 21:19 357  
[   ]net.kollnig.missioncontrol.fdroid.json2023-12-14 08:06 357  
[   ]org.projectmaxs.module.ringermode.json2023-05-28 06:54 357  
[   ]org.projectmaxs.module.wifiaccess.json2023-05-28 06:50 357  
[   ]org.projectmaxs.module.wifichange.json2023-05-28 06:48 357  
[   ]com.duckduckgo.mobile.android.json2023-06-03 12:38 358  
[   ]io.horizontalsystems.bankwallet.json2023-05-18 19:59 358  
[   ]net.programmierecke.radiodroid2.json2023-06-04 13:29 358  
[   ]com.ubergeek42.WeechatAndroid.json2023-04-26 00:16 359  
[   ]net.fabiszewski.ulogger.json2023-07-05 09:06 359  
[   ]net.schueller.peertube.json2023-06-04 13:11 359  
[   ]org.decsync.sparss.floss.json2023-05-15 18:45 359  
[   ]org.smssecure.smssecure.json2023-05-22 16:11 360  
[   ]im.vector.alpha.json2023-05-19 04:48 361  
[   ]org.twistedappdeveloper.statocovid19italia.json2023-05-22 08:49 361  
[   ]superfreeze.tool.android.json2023-06-03 06:47 362  
[   ]me.tsukanov.counter.json2023-06-24 10:34 363  
[   ]net.slions.fulguris.full.fdroid.json2023-06-04 12:52 363  
[   ]com.odnovolov.forgetmenot.json2023-04-26 17:56 364  
[   ]com.gitlab.ardash.appleflinger.android.json2023-04-27 15:41 366  
[   ]com.tmendes.birthdaydroid.json2023-04-26 03:26 366  
[   ]threads.server.json2023-06-03 06:40 366  
[   ]vocabletrainer.heinecke.aron.vocabletrainer.json2023-06-03 06:33 366  
[   ]com.gaurav.avnc.json2023-06-03 11:22 367  
[   ]com.github.howeyc.crocgui.json2023-04-27 17:46 367  
[   ]io.github.lonamiwebs.stringlate.json2023-05-19 00:45 367  
[   ]org.billthefarmer.shorty.json2023-07-03 03:48 367  
[   ]org.projectmaxs.module.contactsread.json2023-05-28 07:00 367  
[   ]org.projectmaxs.module.locationfine.json2023-05-28 06:58 367  
[   ]org.projectmaxs.module.notification.json2023-05-28 06:56 367  
[   ]de.grobox.liberario.json2021-03-13 16:06 368  
[   ]eu.kanade.tachiyomi.json2023-05-19 16:29 368  
[   ]uk.org.ngo.squeezer.json2023-06-03 06:34 369  
[   ]com.coboltforge.dontmind.multivnc.json2023-06-05 09:19 370  
[   ]org.paladyn.mediclog.json2023-05-28 07:47 370  
[   ]ch.logixisland.anuto.json2023-05-27 10:25 371  
[   ]com.celzero.bravedns.json2023-06-09 12:37 371  
[   ]pw.thedrhax.mosmetro.json2023-05-22 03:05 371  
[   ]net.sourceforge.kid3.json2023-06-04 12:32 372  
[   ]com.omelan.cofi.json2023-04-26 17:33 373  
[   ]com.tengu.sharetoclipboard.json2023-04-26 04:07 373  
[   ]fr.chenry.android.freshrss.json2023-05-19 13:41 373  
[   ]ru.playsoftware.j2meloader.json2023-05-22 01:22 373  
[   ]com.example.forgottenumbrella.cardboardmuseum.json2023-04-28 00:48 374  
[   ]com.termoneplus.json2023-04-26 04:07 376  
[   ]de.blau.android.json2023-05-20 07:21 377  
[   ]org.projectmaxs.module.bluetoothadmin.json2023-05-28 07:02 377  
[   ]org.projectmaxs.module.phonestateread.json2023-05-28 06:55 377  
[   ]com.fabienli.dokuwiki.json2023-04-28 00:26 379  
[   ]com.jmstudios.redmoon.json2023-04-27 09:00 379  
[   ]net.ktnx.mobileledger.json2023-07-01 21:24 379  
[   ]com.buzbuz.smartautoclicker.json2023-06-10 11:01 380  
[   ]org.eu.exodus_privacy.exodusprivacy.json2023-05-29 02:40 380  
[   ]app.olauncher.json2023-04-29 01:33 381  
[   ]org.billthefarmer.melodeon.json2023-06-04 07:36 381  
[   ]com.kunzisoft.keepass.libre.json2023-07-10 12:51 384  
[   ]com.mendhak.gpslogger.json2023-04-27 02:07 386  
[   ]com.spisoft.quicknote.json2023-04-26 05:26 386  
[   ]com.gitlab.dibdib.dib2calc.json2023-04-27 15:40 387  
[   ]com.smartpack.packagemanager.json2023-04-26 07:56 387  
[   ]de.uni_potsdam.hpi.openmensa.json2023-07-14 07:39 387  
[   ]helium314.localbackend.json2023-06-02 01:19 387  
[   ]io.github.yawnoc.strokeinput.json2023-05-18 21:57 387  
[   ]me.ccrama.redditslide.json2023-06-05 07:05 387  
[   ]org.blitzortung.android.app.json2023-07-05 08:28 387  
[   ]org.epstudios.epmobile.json2023-05-29 02:47 387  
[   ]org.zephyrsoft.trackworktime.json2023-05-22 05:33 388  
[   ]ru.henridellal.emerald.json2023-05-22 01:36 388  
[   ]ch.rmy.android.statusbar_tacho.json2023-05-26 17:27 390  
[   ]org.nitri.opentopo.json2023-05-28 13:03 392  
[   ]privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.json2023-05-22 03:33 392  
[   ]com.ulicae.cinelog.json2023-04-26 00:09 393  
[   ]fr.gaulupeau.apps.InThePoche.json2023-05-19 12:19 393  
[   ]io.github.deweyreed.clipboardcleaner.json2023-05-19 01:36 393  
[   ]org.traccar.client.json2023-05-22 09:40 393  
[   ]com.ctemplar.app.fdroid.json2023-06-05 09:12 394  
[   ]de.kromke.andreas.musictagger.json2023-05-20 02:02 394  
[   ]org.pacien.tincapp.json2023-06-18 10:54 394  
[   ]com.cheogram.android.json2023-06-05 09:20 395  
[   ]org.gateshipone.odyssey.json2023-05-29 00:59 395  
[   ]org.purplei2p.i2pd.json2023-05-26 07:21 395  
[   ]com.gpl.rpg.AndorsTrail.json2023-04-27 15:00 396  
[   ]org.happypeng.sumatora.android.sumatoradictionary.json2023-05-28 23:01 396  
[   ]ru.yanus171.feedexfork.json2023-05-22 01:04 396  
[   ]openfoodfacts.github.scrachx.openfood.json2023-07-04 07:14 398  
[   ]ca.chancehorizon.paseo.json2023-04-28 22:54 399  
[   ]de.tadris.fitness.json2023-07-17 09:00 399  
[   ]net.vonforst.evmap.json2023-07-05 08:44 400  
[   ]uk.org.boddie.android.weatherforecast.json2023-06-02 06:36 400  
[   ]com.github.andreyasadchy.xtra.json2023-07-15 08:32 401  
[   ]at.bitfire.icsdroid.json2023-04-29 00:18 402  
[   ]be.digitalia.fosdem.json2023-04-28 23:23 402  
[   ]com.coinerella.peercoin.json2023-06-08 11:59 402  
[   ]com.github.axet.torrentclient.json2023-04-27 18:48 402  
[   ]com.junjunguo.pocketmaps.json2023-07-10 14:19 402  
[   ]com.marv42.ebt.newnote.json2023-04-27 03:13 402  
[   ]de.t_dankworth.secscanqr.json2023-07-14 07:43 402  
[   ]joshuatee.wx.json2023-05-18 12:47 402  
[   ]protect.card_locker.json2023-05-22 03:06 402  
[   ]fr.corenting.traficparis.json2023-05-19 13:41 403  
[   ]ch.bailu.aat.json2023-05-25 14:22 404  
[   ]com.github.axet.smsgate.json2023-04-27 19:00 404  
[   ]ws.xsoh.etar.json2023-06-02 06:32 404  
[   ]apps.amine.bou.readerforselfoss.json2023-04-29 01:23 405  
[   ]info.metadude.android.congress.schedule.json2023-05-19 02:59 406  
[   ]org.secuso.privacyfriendlynotes.json2023-12-03 17:21 407  
[   ]com.numguesser.tonio_rpchp.numberguesser.json2023-04-26 18:57 408  
[   ]net.nurik.roman.muzei.json2023-06-29 08:00 410  
[   ]cc.narumi.chaldea.fdroid.json2023-05-31 09:36 411  
[   ]fr.free.nrw.commons.json2023-06-22 08:05 411  
[   ]fr.nocle.passegares.json2023-05-19 08:17 411  
[   ]com.quaap.launchtime.json2023-04-26 13:17 412  
[   ]de.danoeh.antennapod.json2023-05-20 05:58 412  
[   ]de.pixart.messenger.json2023-07-15 07:35 412  
[   ]org.totschnig.myexpenses.json2023-05-22 09:58 412  
[   ]com.workingagenda.democracydroid.json2023-04-25 21:46 415  
[   ]io.timelimit.android.open.json2023-05-18 17:51 415  
[   ]com.pitchedapps.frost.json2023-04-26 14:58 419  
[   ]net.sourceforge.opencamera.json2023-07-05 08:46 419  
[   ]org.moire.opensudoku.json2023-05-28 15:32 419  
[   ]org.yuttadhammo.BodhiTimer.json2023-05-22 05:37 419  
[   ]wseemann.media.romote.json2023-06-01 17:58 419  
[   ]com.vrem.wifianalyzer.json2023-04-25 22:38 420  
[   ]org.secuso.privacyfriendlyweather.json2023-05-22 17:06 420  
[   ]eu.pretix.pretixprint.json2023-05-19 15:14 421  
[   ]moe.matsuri.lite.json2023-06-24 10:32 422  
[TXT]com.gaurav.avnc_24.apk.diffoscope.txt2024-04-04 07:59 425  
[   ]me.hackerchick.catima.json2023-06-05 06:53 425  
[   ]org.shadowice.flocke.andotp.json2023-05-22 16:28 426  
[   ]ar.rulosoft.mimanganu.json2023-04-06 21:19 427  
[   ]com.craigd.lmsmaterial.app.json2023-06-10 10:55 427  
[   ]com.mkulesh.micromath.plus.json2023-04-27 01:30 427  
[   ]com.github.muellerma.tabletoptools.json2023-06-03 11:08 428  
[   ]de.geeksfactory.opacclient.json2023-05-20 03:23 428  
[   ]com.gelakinetic.mtgfam.json2023-11-29 10:07 429  
[   ]com.tobykurien.webapps.json2023-04-26 03:19 430  
[   ]de.baumann.weather.json2023-05-20 07:43 431  
[   ]com.cookiegames.smartcookie.json2023-06-03 15:53 432  
[   ]de.monocles.chat.json2023-07-13 07:47 432  
[   ]com.apps.adrcotfas.goodtime.json2023-06-08 12:16 435  
[   ]com.byagowi.persiancalendar.json2023-06-05 10:03 435  
[   ]dk.kjeldsen.carwingsflutter.json2023-05-19 17:57 435  
[   ]app.olaunchercf.json2023-04-29 01:32 436  
[   ]eu.faircode.netguard.json2023-05-26 08:51 436  
[   ]fr.corenting.convertisseureurofranc.json2023-12-14 14:53 436  
[   ]org.billthefarmer.accordion.json2023-07-03 04:19 436  
[   ]org.billthefarmer.crossword.json2023-07-05 08:32 436  
[   ]com.github.muellerma.prepaidbalance.json2023-06-03 11:08 437  
[   ]com.iven.musicplayergo.json2023-04-27 10:29 437  
[   ]com.dkanada.icecons.json2023-06-09 12:25 441  
[   ]com.physphil.android.unitconverterultimate.json2023-04-26 15:19 441  
[   ]jwtc.android.chess.json2023-05-18 12:11 442  
[   ]com.jarsilio.android.scrambledeggsif.json2023-04-27 10:19 443  
[   ]de.luhmer.owncloudnewsreader.json2023-05-20 01:39 443  
[   ]com.aurora.store.json2023-06-06 11:10 447  
[   ]org.billthefarmer.notes.json2023-07-04 07:05 448  
[   ]ml.docilealligator.infinityforreddit.json2023-06-05 05:37 449  
[   ]com.example.trigger.json2023-04-28 00:27 451  
[   ]com.junkfood.seal.json2023-05-27 08:50 451  
[   ]com.simplemobiletools.thankyou.json2023-04-26 08:58 451  
[   ]de.moekadu.metronome.json2023-07-14 07:54 451  
[   ]link.standen.michael.slideshow.json2023-05-18 10:01 451  
[   ]ru.yourok.torrserve.json2023-06-03 06:52 451  
[   ]com.fr3ts0n.ecu.gui.androbd.json2023-04-27 22:18 452  
[TXT]de.salomax.currencies_10500.apk.diffoscope.txt2023-09-04 08:18 452  
[   ]com.github.gotify.json2023-04-27 17:51 456  
[   ]com.serwylo.lexica.json2023-04-26 10:26 456  
[   ]org.proninyaroslav.libretorrent.json2023-05-28 06:46 457  
[   ]org.xphnx.ameixa.json2023-05-22 06:04 457  
[   ]uk.openvk.android.legacy.json2023-06-03 06:34 457  
[   ]io.simplelogin.android.fdroid.json2023-05-18 18:08 458  
[   ]com.fsck.k9.json2023-04-27 21:54 459  
[   ]de.stephanlindauer.criticalmaps.json2023-07-15 07:29 459  
[   ]it.feio.android.omninotes.foss.json2023-05-18 15:49 459  
[   ]org.koitharu.kotatsu.json2023-05-28 20:06 461  
[   ]at.techbee.jtx.json2023-04-28 23:42 462  
[   ]com.prangesoftwaresolutions.audioanchor.json2023-04-26 13:29 464  
[TXT]org.avmedia.gshockGoogleSync_65.apk.diffoscope.txt2024-05-09 07:24 464  
[   ]com.wmstein.transektcount.json2023-04-25 21:50 465  
[   ]de.schildbach.oeffi.json2023-07-14 07:47 466  
[   ]de.k3b.android.toGoZip.json2023-07-12 07:49 470  
[   ]com.wmstein.tourcount.json2023-04-25 21:53 471  
[   ]com.zell_mbc.medilog.json2023-04-25 20:57 472  
[   ]cx.ring.json2023-05-11 23:09 472  
[   ]ca.rmen.android.poetassistant.json2023-04-28 22:35 473  
[   ]com.github.cvzi.darkmodewallpaper.json2023-04-27 18:18 473  
[   ]com.poupa.vinylmusicplayer.json2023-04-26 13:42 475  
[   ]ryey.easer.json2023-05-22 00:42 475  
[TXT]org.proninyaroslav.libretorrent_4.apk.diffoscope.txt2023-05-28 06:43 476  
[   ]org.tlhInganHol.android.klingonassistant.json2023-05-22 10:15 478  
[   ]com.keylesspalace.tusky.json2023-07-10 13:22 479  
[   ]free.rm.skytube.oss.json2023-05-19 13:11 479  
[TXT]io.github.divverent.aaaaxy_103030043.apk.diffoscope.txt2024-04-16 08:41 479  
[   ]com.github.muellerma.mute_reminder.json2023-07-15 08:27 481  
[   ]opencontacts.open.com.opencontacts.json2023-06-28 07:13 481  
[   ]org.runnerup.free.json2023-05-27 06:43 482  
[   ]com.github.axet.filemanager.json2023-04-27 19:19 483  
[   ]org.sufficientlysecure.keychain.json2023-05-22 13:10 484  
[   ]de.reimardoeffinger.quickdic.json2023-05-19 23:27 489  
[   ]org.hlwd.bible_multi_the_life.json2023-05-28 22:26 491  
[   ]com.github.axet.callrecorder.json2023-04-27 19:24 492  
[   ]com.health.openscale.json2023-04-27 13:44 492  
[   ]de.kaffeemitkoffein.imagepipe.json2023-07-15 07:45 492  
[   ]org.commonvoice.saverio.json2023-05-29 04:09 492  
[   ]org.eehouse.android.xw4.json2023-05-29 02:58 492  
[   ]org.mozilla.fennec_fdroid.json2023-07-06 09:30 493  
[   ]org.moire.ultrasonic.json2023-05-28 15:31 496  
[   ]org.primftpd.json2023-12-03 18:16 499  
[   ]com.android.gpstest.osmdroid.json2023-06-08 12:19 501  
[   ]com.beemdevelopment.aegis.json2023-06-10 11:06 501  
[   ]com.simplemobiletools.draw.pro.json2023-04-26 09:35 501  
[   ]info.dvkr.screenstream.json2023-05-19 03:08 501  
[   ]org.fdroid.fdroid.privileged.json2023-05-29 02:16 501  
[   ]player.efis.mfd.json2023-05-22 04:51 503  
[   ]com.secuso.privacyFriendlyCodeScanner.json2023-04-26 10:38 506  
[   ]com.tailscale.ipn.json2023-04-26 04:37 507  
[TXT]com.github.catfriend1.syncthingandroid_1260100.apk.diffoscope.txt2024-04-04 07:55 509  
[TXT]com.github.catfriend1.syncthingandroid_1270300.apk.diffoscope.txt2024-04-04 07:55 509  
[   ]com.atharok.barcodescanner.json2023-06-05 11:16 511  
[   ]com.martinmimigames.simplefileexplorer.json2023-12-15 07:50 511  
[   ]com.igisw.openmoneybox.json2023-04-27 13:15 513  
[   ]cz.martykan.forecastie.json2023-05-11 22:16 513  
[   ]xyz.hisname.fireflyiii.json2023-06-03 06:29 514  
[   ]info.zamojski.soft.towercollector.json2023-05-19 02:25 516  
[   ]org.mian.gitnex.json2023-12-03 19:28 518  
[   ]com.simplemobiletools.calculator.json2023-04-26 09:59 519  
[   ]de.arnowelzel.android.periodical.json2023-05-11 20:08 519  
[   ]com.simplemobiletools.clock.json2023-04-26 09:50 521  
[   ]app.crossword.yourealwaysbe.forkyz.json2023-04-29 01:46 522  
[   ]net.taler.wallet.fdroid.json2023-12-14 07:11 522  
[   ]fr.ralala.hexviewer.json2023-05-19 07:53 526  
[   ]com.donnnno.arcticons.light.json2023-06-10 10:48 530  
[   ]com.flxrs.dankchat.json2023-04-28 00:00 530  
[   ]net.gsantner.markor.json2023-07-05 09:02 530  
[   ]com.forrestguice.suntimescalendars.json2023-04-27 22:40 533  
[   ]de.salomax.currencies.json2023-12-14 16:55 535  
[   ]com.infomaniak.sync.json2023-12-15 12:44 537  
[   ]com.DartChecker.json2023-06-03 14:26 538  
[   ]fr.neamar.kiss.json2023-05-19 08:21 539  
[   ]org.nutritionfacts.dailydozen.json2023-05-28 12:43 541  
[   ]io.github.gsantner.memetastic.json2023-05-19 00:56 542  
[   ]host.stjin.anonaddy.json2023-05-19 06:04 544  
[   ]com.simplemobiletools.voicerecorder.json2023-04-26 08:50 545  
[   ]org.wikipedia.json2023-05-22 07:10 548  
[   ]com.seafile.seadroid2.json2023-04-26 11:11 551  
[   ]de.baumann.browser.json2023-05-11 19:30 555  
[   ]org.unifiedpush.distributor.nextpush.json2023-05-22 08:40 555  
[   ]org.purple.smoke.json2023-05-28 06:40 556  
[   ]org.woheller69.weather.json2023-05-22 06:26 556  
[   ]org.y20k.transistor.json2023-05-22 05:50 558  
[   ]com.orgzly_78.apk.json2021-03-09 08:16 559  
[   ]com.guillaumepayet.remotenumpad.json2023-04-27 14:40 561  
[   ]com.yacgroup.yacguide.dev.json2023-04-25 21:16 562  
[   ]sh.ftp.rocketninelabs.meditationassistant.opensource.json2023-05-21 23:43 562  
[   ]com.orgzly_152.apk.json2021-03-09 08:16 563  
[   ]io.github.wulkanowy.json2023-05-18 22:41 566  
[   ]com.github.muellerma.coffee.json2023-06-03 11:09 567  
[   ]com.samco.trackandgraph.json2023-04-26 11:33 567  
[   ]org.quantumbadger.redreader.json2023-05-27 06:45 570  
[   ]com.oF2pks.classyshark3xodus.json2023-12-15 06:25 576  
[   ]nl.mpcjanssen.simpletask.json2023-06-30 07:45 577  
[   ]com.fsck.k9_27003.apk.json2021-03-10 00:16 578  
[   ]com.simplemobiletools.camera.json2023-04-26 09:53 579  
[   ]com.foobnix.pro.pdf.reader.json2023-04-27 23:03 580  
[   ]com.simplemobiletools.applauncher.json2023-12-15 04:52 580  
[   ]de.christinecoenen.code.zapp.json2023-05-20 06:21 580  
[   ]org.billthefarmer.scope.json2023-07-04 07:05 580  
[   ]io.timelimit.android.aosp.direct.json2023-05-18 17:51 581  
[   ]com.corona_info_12.apk.json2021-03-10 05:55 582  
[   ]io.github.divverent.aaaaxy.json2023-06-02 01:14 582  
[   ]org.andstatus.app.json2023-07-05 08:37 583  
[   ]com.appmindlab.nano.json2023-06-04 00:29 584  
[   ]org.openhab.habdroid.json2023-05-28 12:08 584  
[   ]site.leos.apps.lespas.json2023-05-21 23:05 585  
[   ]dev.lucanlm.antimine.json2023-07-14 07:35 589  
[   ]org.openobservatory.ooniprobe.json2023-05-28 08:57 590  
[   ]org.billthefarmer.siggen.json2023-07-05 08:29 592  
[   ]app.fedilab.lite_319.apk.json2021-02-27 15:49 593  
[   ]com.donnnno.arcticons.json2023-06-10 10:49 593  
[   ]app.fedilab.lite_380.apk.json2021-03-13 09:53 594  
[   ]org.schabi.newpipe.json2023-05-22 17:52 594  
[   ]it.reyboz.bustorino.json2023-05-18 13:29 597  
[   ]com.ghostsq.commander.json2023-04-27 20:46 598  
[   ]com.oF2pks.netscope_6.apk.json2021-03-09 08:40 598  
[   ]com.oF2pks.netscope_4.apk.json2021-03-09 08:40 599  
[   ]com.podverse.fdroid_3.apk.json2021-03-13 14:17 599  
[   ]com.vincent_falzon.discreetlauncher.json2023-04-25 22:51 599  
[   ]com.github.metacubex.clash.meta.json2023-06-03 11:10 601  
[   ]app.fedilab.tubelab_33.apk.json2021-03-13 10:00 604  
[   ]com.x1unix.s60icons_110.apk.json2021-03-08 21:52 608  
[   ]be.mygod.vpnhotspot_217.apk.json2021-02-27 14:31 609  
[   ]de.grobox.liberario_115.apk.json2021-03-08 15:35 609  
[   ]de.grobox.liberario_117.apk.json2021-03-08 15:35 609  
[   ]de.grobox.liberario_118.apk.json2021-03-13 16:06 609  
[   ]io.github.fvasco.pinpoi.json2023-05-19 01:01 610  
[   ]com.darkempire78.opencalculator.json2023-07-15 08:37 611  
[   ]com.github.axet.hourlyreminder.json2023-04-27 19:04 612  
[   ]com.github.dfa.diaspora_android.json2023-04-27 18:04 613  
[   ]at.bitfire.davdroid.json2023-04-29 00:29 614  
[   ]com.etesync.syncadapter.json2023-04-28 01:33 614  
[   ]org.xphnx.ameixamonochrome.json2023-05-22 05:59 614  
[   ]im.quicksy.client.json2023-05-19 04:48 615  
[   ]com.foxykeep.lifecounter_2.apk.json2021-03-10 00:30 616  
[   ]com.wangdaye.mysplash_371.apk.json2021-03-08 22:50 619  
[   ]com.simplemobiletools.flashlight.json2023-04-26 09:28 623  
[   ]com.hearham.repeaterstart_3.apk.json2021-03-13 12:46 625  
[   ]com.utazukin.ichaival.json2023-12-14 23:10 625  
[   ]io.homeassistant.companion.android.minimal.json2023-05-18 21:25 625  
[   ]app.fedilab.fedilabtube_33.apk.json2021-03-13 09:52 626  
[   ]us.spotco.malwarescanner.json2023-06-02 06:35 626  
[   ]com.orgzly_117.apk.json2021-03-09 08:17 628  
[   ]com.metinkale.prayer_215.apk.json2021-03-09 13:14 630  
[   ]budo.budoist_33.apk.json2021-02-27 14:18 632  
[   ]me.zhanghai.android.files_23.apk.json2022-02-04 10:48 632  
[   ]com.kabouzeid.gramophone_176.apk.json2021-03-09 16:37 634  
[   ]com.kabouzeid.gramophone_177.apk.json2021-04-02 09:37 634  
[   ]com.kabouzeid.gramophone_179.apk.json2021-03-13 12:58 634  
[   ]com.tunjid.fingergestures_48.apk.json2021-03-09 01:23 634  
[   ]com.u17od.upm_20.apk.json2021-03-09 01:05 634  
[   ]com.kylecorry.trail_sense.json2023-04-27 07:07 635  
[   ]dnsfilter.android.json2023-05-19 17:32 639  
[   ]net.sourceforge.dibdib.android.dib2qm.json2023-06-04 12:35 641  
[   ]io.mainframe.hacs.json2023-06-30 09:10 643  
[   ]net.ivpn.client_94.apk.json2022-03-20 15:40 647  
[   ]com.github.axet.audiorecorder.json2023-04-27 19:44 651  
[   ]com.github.cvzi.screenshottile.json2023-04-27 18:17 651  
[   ]com.github.ashutoshgngwr.noice.json2023-04-27 20:00 652  
[   ]com.beckhamd.nasaimageryfetcher_7.apk.json2021-04-02 08:54 653  
[   ]com.nkanaev.comics_7.apk.json2021-03-09 10:01 662  
[   ]com.brentpanther.bitcoinwidget.json2023-06-23 11:05 663  
[   ]com.uberspot.a2048_24.apk.json2021-03-09 00:57 664  
[   ]hu.vmiklos.plees_tracker.json2023-05-19 05:22 665  
[   ]com.pvpc.precio_luz_2.apk.json2021-03-15 08:23 666  
[   ]com.biglybt.android.client_1030106.apk.json2021-03-13 11:20 668  
[   ]com.f2prateek.dfg_113.apk.json2021-03-10 00:53 668  
[   ]org.billthefarmer.tuner.json2023-07-05 08:28 668  
[   ]com.gladis.tictactoe_1.apk.json2021-03-09 21:07 670  
[   ]com.podverse.fdroid_2.apk.json2021-03-14 07:58 670  
[   ]org.asteroidos.sync.json2023-07-04 07:10 670  
[   ]com.mridang.cellinfo_4.apk.json2021-03-09 11:51 674  
[   ]com.mridang.wifiinfo_3.apk.json2021-03-09 11:46 674  
[   ]cat.mvmike.minimalcalendarwidget.json2023-04-28 22:23 675  
[   ]app.mlauncher.json2023-06-24 12:52 678  
[   ]be.mygod.vpnhotspot_220.apk.json2021-04-02 08:27 678  
[   ]ch.rmy.android.http_shortcuts.json2023-05-27 10:22 678  
[   ]de.grobox.liberario_112.apk.json2021-03-08 15:37 679  
[   ]de.grobox.liberario_113.apk.json2021-03-08 15:36 679  
[   ]player.efis.pfd.json2023-05-22 04:48 679  
[   ]com.qubling.sidekick_16.apk.json2021-03-09 06:33 680  
[   ]fr.cph.chicago.foss_205.apk.json2022-02-05 16:37 681  
[   ]org.moire.ultrasonic_91.apk.json2022-03-19 03:58 681  
[   ]com.b44t.messenger.json2023-06-05 11:11 682  
[   ]com.github.catfriend1.syncthingandroid.json2023-04-27 18:26 682  
[   ]com.amaze.filemanager_77.apk.json2021-03-10 16:31 683  
[   ]com.metinkale.prayer_174.apk.json2021-03-09 13:20 686  
[   ]com.github.bmx666.appcachecleaner.json2023-07-13 08:35 687  
[   ]app.pott.kaffeepott.androidclient_10104.apk.json2021-03-13 10:04 689  
[   ]com.eventyay.organizer_17.apk.json2021-03-10 01:18 690  
[   ]com.amaze.filemanager_54.apk.json2021-03-10 16:40 693  
[   ]com.amaze.filemanager_61.apk.json2021-03-10 16:36 693  
[   ]com.simplemobiletools.contacts.pro.json2023-04-26 09:48 702  
[   ]com.wownero.wownerujo_1130.apk.json2021-03-08 21:54 702  
[   ]rkr.simplekeyboard.inputmethod.json2023-12-03 15:59 703  
[   ]com.simplecity.amp_pro_5000.apk.json2021-03-13 14:39 706  
[   ]com.adityakamble49.dcipher_9.apk.json2021-03-10 17:20 707  
[   ]com.bijoysingh.quicknote_145.apk.json2021-03-10 13:04 710  
[   ]com.ferrarid.converterpro_25.apk.json2021-03-15 07:15 710  
[   ]com.ferrarid.converterpro_27.apk.json2021-03-16 07:10 710  
[   ]com.kabouzeid.gramophone_167.apk.json2021-03-09 16:38 710  
[   ]net.bible.android.activity.json2023-07-05 09:08 710  
[   ]com.zegoggles.smssync_1557.apk.json2021-03-08 20:19 712  
[   ]com.adityakamble49.dcipher_10.apk.json2021-03-10 17:21 714  
[   ]com.jarsilio.android.waveup.json2023-04-27 10:17 715  
[   ]de.spiritcroc.riotx_40100430.apk.json2021-03-13 16:29 720  
[   ]com.money.manager.ex_1000.apk.json2021-03-09 12:42 722  
[   ]com.simplemobiletools.dialer.json2023-04-26 09:37 722  
[   ]com.thirtydegreesray.openhub_30.apk.json2021-03-09 02:46 728  
[   ]nodomain.freeyourgadget.gadgetbridge.json2023-06-04 10:42 733  
[   ]de.dennisguse.opentracks.json2023-12-14 18:49 742  
[   ]com.foobnix.pro.pdf.reader_4000.apk.json2021-03-15 07:30 746  
[   ]nl.asymmetrics.droidshows.json2023-07-01 20:59 749  
[   ]com.simplemobiletools.smsmessenger.json2023-04-26 09:03 751  
[   ]d.d.meshenger.json2023-12-14 20:25 763  
[   ]com.simplemobiletools.notes.pro.json2023-04-26 09:04 770  
[   ]de.storchp.fdroidbuildstatus.json2023-07-15 07:29 771  
[   ]org.hlwd.bible.json2023-05-28 22:38 772  
[   ]de.micmun.android.nextcloudcookbook_140.apk.json2021-03-13 16:19 776  
[   ]ca.momi.lift_2.apk.json2023-04-28 22:41 780  
[   ]cx.ring_286.apk.json2023-05-11 23:45 782  
[   ]ademar.bitac_5.apk.json2023-04-29 01:56 785  
[   ]com.github.andremiras.etheroll_721203008.apk.json2021-03-09 23:12 789  
[   ]ds.pulsar_7.apk.json2024-05-20 07:39 790  
[   ]com.fediphoto_13.apk.json2023-04-28 00:15 792  
[   ]cz.hernik.kaku_3.apk.json2023-05-11 22:37 792  
[   ]ds.pulsar_3.apk.json2024-05-14 07:23 792  
[   ]app.olauncher_30.apk.json2023-04-29 01:33 793  
[   ]app.olauncher_33.apk.json2023-04-29 01:33 794  
[   ]com.termux.api_48.apk.json2023-04-26 04:01 796  
[   ]com.termux.gui_5.apk.json2023-01-08 05:40 796  
[   ]souch.smp_31.apk.json2024-05-15 08:37 797  
[   ]app.olauncher_37.apk.json2023-04-29 01:33 798  
[   ]com.gh4a_71.apk.json2024-04-04 07:58 798  
[   ]com.noto_54.apk.json2024-05-16 13:57 798  
[   ]de.sudoq_28.apk.json2023-09-03 09:51 798  
[   ]de.yaacc_28.apk.json2024-04-15 07:02 798  
[   ]io.pslab_22.apk.json2024-04-16 08:23 798  
[   ]app.halma_11.apk.json2024-05-14 16:56 799  
[   ]souch.smp_30.apk.json2024-05-15 08:37 799  
[   ]com.gh4a_73.apk.json2024-04-04 07:58 800  
[   ]com.iyps_143.apk.json2024-04-04 07:30 800  
[   ]app.halma_10.apk.json2024-05-14 16:11 801  
[   ]app.halma_13.apk.json2024-05-14 14:44 801  
[   ]net.dcnnt_17.apk.json2023-07-05 09:08 801  
[   ]com.iyps_146.apk.json2024-04-04 07:30 802  
[   ]com.simplemobiletools.filemanager.pro.json2023-12-15 04:51 802  
[   ]org.kaqui_82.apk.json2024-05-12 10:44 802  
[   ]com.iyps_120.apk.json2024-04-04 07:30 803  
[   ]com.iyps_142.apk.json2024-04-04 07:30 803  
[   ]com.nunti_16.apk.json2024-04-04 07:13 803  
[   ]com.unciv.app_543.apk.json2023-04-25 23:36 803  
[   ]net.dcnnt_19.apk.json2023-07-04 07:50 803  
[   ]net.dcnnt_23.apk.json2024-05-07 23:00 803  
[   ]org.cry.otp_22.apk.json2024-01-13 07:19 803  
[   ]org.cry.otp_23.apk.json2024-05-07 18:16 803  
[   ]com.drip_25.apk.json2024-04-02 08:07 804  
[   ]de.kromke.andreas.unpopmusicplayerfree.json2023-05-20 01:53 804  
[   ]net.dcnnt_24.apk.json2024-05-09 07:39 804  
[   ]net.e1547_91.apk.json2024-05-16 15:59 804  
[   ]org.kaqui_84.apk.json2024-05-17 09:17 804  
[   ]com.nunti_17.apk.json2024-03-31 21:17 805  
[   ]com.unciv.app_552.apk.json2023-04-25 23:34 805  
[   ]net.dcnnt_25.apk.json2024-05-07 23:00 805  
[   ]net.dcnnt_26.apk.json2024-05-09 07:39 805  
[   ]net.dcnnt_27.apk.json2024-05-09 07:39 805  
[   ]net.e1547_90.apk.json2024-05-17 08:57 805  
[   ]org.kaqui_78.apk.json2024-05-12 10:44 805  
[   ]org.kaqui_81.apk.json2024-05-14 07:06 805  
[   ]de.fff.ccgt_14.apk.json2024-01-10 07:59 806  
[   ]cx.ring_399.apk.json2024-03-27 07:52 807  
[   ]de.fff.ccgt_13.apk.json2023-05-20 03:40 807  
[   ]org.btcmap_47.apk.json2024-05-09 07:13 807  
[   ]taco.scoop_28.apk.json2023-09-21 06:40 807  
[   ]app.olaunchercf_11.apk.json2023-01-11 01:55 808  
[   ]com.jerboa_45.apk.json2024-04-04 07:29 808  
[   ]com.jerboa_46.apk.json2024-04-04 07:29 808  
[   ]com.jerboa_49.apk.json2024-04-04 07:29 808  
[   ]com.jerboa_57.apk.json2024-04-03 07:32 808  
[   ]com.jerboa_60.apk.json2024-04-04 07:29 808  
[   ]cx.ring_352.apk.json2024-03-27 07:55 808  
[   ]cx.ring_402.apk.json2024-03-27 07:52 808  
[   ]cx.ring_406.apk.json2024-03-27 07:52 808  
[   ]cx.ring_421.apk.json2024-05-17 08:04 808  
[   ]de.mlex.same_1.apk.json2024-05-16 15:09 808  
[   ]com.jerboa_48.apk.json2024-04-03 07:32 809  
[   ]com.jerboa_55.apk.json2024-04-04 07:29 809  
[   ]com.minar.birday_15.apk.json2023-04-27 01:55 809  
[   ]cx.ring_353.apk.json2024-03-27 07:55 809  
[   ]im.fdx.v2ex_57.apk.json2024-04-16 08:48 809  
[   ]im.fdx.v2ex_69.apk.json2024-04-16 08:48 809  
[   ]com.jerboa_19.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_20.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_21.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_22.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_53.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_59.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_61.apk.json2024-04-04 07:29 810  
[   ]com.jerboa_63.apk.json2024-04-04 07:29 810  
[   ]com.termoneplus_352.apk.json2023-04-26 04:07 810  
[   ]com.termoneplus_353.apk.json2023-04-26 04:07 810  
[   ]cx.ring_346.apk.json2024-03-27 07:55 810  
[   ]cx.ring_354.apk.json2024-03-27 07:52 810  
[   ]cx.ring_355.apk.json2024-03-27 07:52 810  
[   ]cx.ring_356.apk.json2024-03-27 07:52 810  
[   ]cx.ring_358.apk.json2024-03-27 07:52 810  
[   ]cx.ring_361.apk.json2024-03-27 07:52 810  
[   ]cx.ring_362.apk.json2024-03-27 07:52 810  
[   ]cx.ring_364.apk.json2024-03-27 07:52 810  
[   ]cx.ring_365.apk.json2024-03-27 07:52 810  
[   ]cx.ring_396.apk.json2024-03-27 07:52 810  
[   ]cx.ring_400.apk.json2024-03-27 07:52 810  
[   ]cx.ring_401.apk.json2024-03-27 07:52 810  
[   ]cx.ring_405.apk.json2024-03-27 07:52 810  
[   ]cx.ring_407.apk.json2024-03-27 07:52 810  
[   ]cx.ring_409.apk.json2024-03-27 07:51 810  
[   ]cx.ring_410.apk.json2024-03-27 07:51 810  
[   ]im.fdx.v2ex_60.apk.json2024-04-15 04:23 810  
[   ]luke.kfz_10002.apk.json2024-03-16 07:21 810  
[   ]luke.kfz_10003.apk.json2024-05-09 07:48 810  
[   ]ogz.tripeaks_5.apk.json2023-07-01 20:57 810  
[   ]ademar.bitac_7.apk.json2024-04-03 08:44 811  
[   ]com.orgzly_168.apk.json2024-04-04 07:10 811  
[   ]com.ruesga.rview_69.apk.json2023-04-26 11:58 811  
[   ]com.termoneplus_354.apk.json2023-04-26 04:07 811  
[   ]com.termoneplus_360.apk.json2023-04-26 04:02 811  
[   ]im.fdx.v2ex_48.apk.json2024-04-16 08:48 811  
[   ]im.fdx.v2ex_58.apk.json2024-04-15 04:23 811  
[   ]org.primftpd_53.apk.json2023-05-28 07:06 811  
[   ]com.atr.hiit_3.apk.json2023-06-08 12:14 812  
[   ]com.baldo.bob_2.apk.json2024-05-16 09:26 812  
[   ]luke.kfz_10004.apk.json2024-05-09 07:48 812  
[   ]ademar.bitac_6.apk.json2024-04-04 08:43 813  
[   ]com.ahorcado_7.apk.json2023-06-10 11:17 813  
[   ]com.xrcbapp_20.apk.json2024-04-04 06:39 813  
[   ]de.yaacc_30000.apk.json2024-04-16 09:02 813  
[   ]de.yaacc_30300.apk.json2024-04-16 09:02 813  
[   ]de.yaacc_40000.apk.json2024-04-16 09:02 813  
[   ]de.yaacc_40001.apk.json2024-04-16 09:02 813  
[   ]de.yaacc_40002.apk.json2024-04-15 07:02 813  
[   ]de.yaacc_40003.apk.json2024-04-16 09:02 813  
[   ]de.yaacc_40100.apk.json2024-04-16 09:02 813  
[   ]eu.dfdx.jslab_1.apk.json2024-04-16 08:58 813  
[   ]im.fdx.v2ex_50.apk.json2024-04-16 08:48 813  
[   ]luke.kfz_10001.apk.json2023-05-18 09:50 813  
[   ]me.lucky.red_9.apk.json2024-05-08 00:01 813  
[   ]wtf.nbd.obw_12.apk.json2024-05-15 07:50 813  
[   ]com.myclosetx_1.apk.json2024-05-14 07:28 814  
[   ]com.orgzly_171.apk.json2024-04-04 07:10 814  
[   ]org.primftpd_54.apk.json2024-01-13 06:56 814  
[   ]org.primftpd_61.apk.json2024-05-15 12:57 814  
[   ]org.primftpd_63.apk.json2024-05-15 12:57 814  
[   ]org.primftpd_64.apk.json2024-05-15 12:57 814  
[   ]spam.blocker_16.apk.json2024-05-20 08:09 814  
[   ]app.weatheroverview_1.apk.json2023-04-29 00:59 815  
[   ]com.termux_118.apk.json2024-04-03 06:52 815  
[   ]itkach.aard2_51.apk.json2024-03-16 07:26 815  
[   ]itkach.aard2_53.apk.json2024-04-16 08:21 815  
[   ]itkach.aard2_54.apk.json2024-04-16 08:21 815  
[   ]itkach.aard2_55.apk.json2024-04-16 08:21 815  
[   ]net.stargw.fx_10.apk.json2024-03-31 14:01 815  
[   ]ogz.tripeaks_10.apk.json2023-06-29 07:23 815  
[   ]at.h4x.metaapp_10102.apk.json2023-04-29 00:16 816  
[   ]ch.bailu.aat_31.apk.json2023-05-26 17:33 816  
[   ]com.baldo.bob_5.apk.json2024-05-16 09:26 816  
[   ]com.github.gotify_20.apk.json2023-04-27 17:53 816  
[   ]com.unitstool_8.apk.json2024-04-04 06:44 816  
[   ]io.mrarm.irc_13.apk.json2024-04-16 08:23 816  
[   ]itkach.aard2_47.apk.json2024-01-13 08:05 816  
[   ]ogz.tripeaks_21.apk.json2024-05-09 07:27 816  
[   ]org.jsl.wfwt_16.apk.json2024-05-14 07:06 816  
[   ]org.primftpd_59.apk.json2024-05-15 12:57 816  
[   ]org.primftpd_62.apk.json2024-05-15 12:57 816  
[   ]threads.thor_74.apk.json2023-09-21 06:39 816  
[   ]app.mlauncher_57.apk.json2024-02-03 23:56 817  
[   ]ca.snoe.deedum_16.apk.json2023-04-28 22:25 817  
[   ]com.gianlu.dnshero_31.apk.json2023-04-27 20:33 817  
[   ]com.github.cythara_23.apk.json2023-04-27 18:15 817  
[   ]com.matt.bolton_5.apk.json2024-04-04 07:20 817  
[   ]com.matt.bolton_6.apk.json2024-04-04 07:20 817  
[   ]com.unciv.app_545.apk.json2023-04-25 23:36 817  
[   ]com.unciv.app_564.apk.json2023-04-25 23:34 817  
[   ]geddit.buzl.uk_7.apk.json2024-05-16 15:16 817  
[   ]net.stargw.fx_13.apk.json2024-05-07 21:41 817  
[   ]rak.pixellwp_12.apk.json2024-05-15 10:36 817  
[   ]rocks.mucke_123.apk.json2024-05-15 10:35 817  
[   ]ru.ikkui.achie_9.apk.json2024-05-15 09:34 817  
[   ]ryey.easer_128.apk.json2024-05-15 09:27 817  
[   ]com.minar.randomix_31.apk.json2023-04-27 01:55 818  
[   ]com.porg.gugal_9.apk.json2024-04-04 07:08 818  
[   ]exa.lnx.a_655.apk.json2024-04-16 08:56 818  
[   ]io.naox.inbe_27.apk.json2024-05-12 12:40 818  
[   ]io.naox.inbe_29.apk.json2024-05-16 15:45 818  
[   ]me.lucky.wyfy_8.apk.json2024-05-09 07:45 818  
[   ]rak.pixellwp_11.apk.json2024-05-15 10:36 818  
[   ]ru.ikkui.achie_5.apk.json2024-01-19 12:15 818  
[   ]com.atr.tedit_27.apk.json2023-06-10 11:09 819  
[   ]com.minar.randomix_32.apk.json2023-04-27 01:55 819  
[   ]com.qfs.pagan_48.apk.json2024-05-17 07:35 819  
[   ]me.lucky.volta_7.apk.json2024-05-09 07:47 819  
[   ]net.stargw.fok_63.apk.json2024-05-09 07:31 819  
[   ]org.walleth_502.apk.json2023-05-22 07:31 819  
[   ]com.blockbasti.justanotherworkouttimer_20210311.apk.json2021-04-02 08:59 820  
[   ]com.matt.bolton_4.apk.json2024-04-04 07:20 820  
[   ]exa.lnx.a_621.apk.json2023-05-19 14:25 820  
[   ]exa.lnx.a_645.apk.json2024-04-16 08:56 820  
[   ]exa.lnx.a_650.apk.json2024-04-15 05:54 820  
[   ]net.stargw.fok_64.apk.json2024-05-09 07:31 820  
[   ]org.adaway_60100.apk.json2024-05-09 07:26 820  
[   ]us.spotco.maps_26.apk.json2024-05-15 07:57 820  
[   ]app.mlauncher_35.apk.json2024-02-03 23:56 821  
[   ]app.mlauncher_38.apk.json2024-01-31 09:01 821  
[   ]app.mlauncher_45.apk.json2024-01-30 10:08 821  
[   ]app.mlauncher_53.apk.json2024-02-03 23:56 821  
[   ]app.mlauncher_54.apk.json2024-02-03 23:56 821  
[   ]app.mlauncher_56.apk.json2024-02-03 23:56 821  
[   ]app.mlauncher_63.apk.json2024-04-04 08:40 821  
[   ]app.upvpn.upvpn_6.apk.json2024-05-14 15:56 821  
[   ]com.atr.tedit_17.apk.json2023-06-10 11:09 821  
[   ]com.blockbasti.justanotherworkouttimer_20210227.apk.json2021-03-15 06:57 821  
[   ]com.github.cetoolbox_5.apk.json2023-04-27 18:18 821  
[   ]com.meteocool_34.apk.json2024-04-04 07:18 821  
[   ]com.mikifus.padland_23.apk.json2023-04-27 02:01 821  
[   ]com.newsblur_207.apk.json2024-03-31 22:01 821  
[   ]com.pcinpact_273.apk.json2024-04-04 07:10 821  
[   ]com.podverse.fdroid_6.apk.json2023-04-26 14:18 821  
[   ]de.nproth.pin_12.apk.json2023-09-06 07:02 821  
[   ]me.ash.reader_19.apk.json2024-05-09 07:47 821  
[   ]threads.thor_124.apk.json2024-05-15 08:23 821  
[   ]threads.thor_152.apk.json2024-05-15 08:23 821  
[   ]us.spotco.maps_22.apk.json2024-05-15 07:57 821  
[   ]app.upvpn.upvpn_5.apk.json2024-05-14 17:00 822  
[   ]ch.mydoli.focal_1.apk.json2024-05-14 17:04 822  
[   ]com.databag_12004.apk.json2024-05-16 09:54 822  
[   ]com.klee.sapio_13.apk.json2024-04-04 07:25 822  
[   ]com.pcinpact_271.apk.json2024-04-04 07:10 822  
[   ]com.porg.gugal_5.apk.json2024-04-04 07:08 822  
[   ]com.qfs.pagan_10.apk.json2024-05-13 07:39 822  
[   ]com.qfs.pagan_31.apk.json2024-05-14 07:27 822  
[   ]de.bwl.lfdi.app_2.apk.json2024-03-26 11:07 822  
[   ]foehnix.widget_34.apk.json2024-01-10 07:35 822  
[   ]in.amfoss.raag_1.apk.json2023-05-19 03:55 822  
[   ]me.ash.reader_16.apk.json2024-05-09 07:47 822  
[   ]net.stargw.fat_15.apk.json2024-05-16 16:11 822  
[   ]net.stargw.fok_55.apk.json2024-01-05 21:13 822  
[   ]net.stargw.fok_56.apk.json2024-01-05 21:13 822  
[   ]net.stargw.fok_57.apk.json2024-01-05 21:13 822  
[   ]om.sstvencoder_30.apk.json2024-05-09 07:27 822  
[   ]om.sstvencoder_31.apk.json2024-05-09 07:27 822  
[   ]s1m.savertuner_6.apk.json2024-05-15 09:16 822  
[   ]s1m.savertuner_7.apk.json2024-05-15 09:16 822  
[   ]threads.thor_122.apk.json2024-05-15 08:26 822  
[   ]threads.thor_143.apk.json2024-05-15 08:23 822  
[   ]threads.thor_151.apk.json2024-05-15 08:23 822  
[   ]threads.thor_154.apk.json2024-05-15 08:23 822  
[   ]us.spotco.maps_30.apk.json2024-05-15 07:57 822  
[   ]yetzio.yetcalc_8.apk.json2024-02-17 06:27 822  
[   ]app.mlauncher_30.apk.json2024-01-31 09:01 823