F-Droid Verification Server

F-Droid Verification Server

This is the Verification Server for https://f-droid.org. It rebuilds apps from source that were built by f-droid.org and checks that the results match. If they match, then there is a file named *.verified.txt added next to the APK that was verified. If not, then there is output from diffoscope in HTML and text.

The hardware resources to run this are provided by p≡p

[ICO]NameLast modifiedSizeDescription

[DIR]apache-logs/2019-11-05 21:31 -  
[DIR]binaries/2022-11-07 22:24 -  
[DIR]build-metadata/2018-01-25 15:55 -  
[DIR]check-fdroid-apk/2018-06-01 07:19 -  
[DIR]tmp/2013-07-10 06:56 -  
[DIR]unsigned/2022-11-26 17:45 -  
[   ]org.fdroid.fdroid_1000002.apk.json2022-02-01 06:26 0  
[   ]test-jar2017-01-03 18:17 25  
[TXT]a2dp.Vol_135.apk.verified.txt2017-05-07 15:03 36  
[TXT]anupam.acrylic_15.apk.verified.txt2017-05-07 14:46 36  
[TXT]app.varlorg.unote.verified.txt2017-01-13 10:47 36  
[TXT]app.varlorg.unote_7.apk.verified.txt2017-05-07 14:46 36  
[TXT]at.linuxtage.companion_700138.apk.verified.txt2017-05-07 14:41 36  
[TXT]at.linuxtage.companion_700144.apk.verified.txt2017-05-07 14:41 36  
[TXT]au.com.wallaceit.reddinator_62.apk.verified.txt2017-05-07 14:27 36  
[TXT]be.ppareit.swiftp_free_21301.apk.verified.txt2017-05-07 14:18 36  
[TXT]br.com.frs.foodrestrictions_2.apk.verified.txt2017-05-07 14:11 36  
[TXT]ca.cmetcalfe.locationshare_3.apk.verified.txt2017-05-07 13:58 36  
[TXT]ca.cmetcalfe.xposed.flatconnectivityicons_1.apk.verified.txt2017-05-07 13:58 36  
[TXT]ca.farrelltonsolar.classic.verified.txt2017-01-13 09:52 36  
[TXT]ca.farrelltonsolar.classic_245.apk.verified.txt2017-05-07 13:51 36  
[TXT]ca.farrelltonsolar.classic_250.apk.verified.txt2017-05-07 13:51 36  
[TXT]ca.rmen.android.poetassistant_11800.apk.verified.txt2017-05-07 13:50 36  
[TXT]ca.rmen.android.scrumchatter_10602.apk.verified.txt2017-05-07 13:50 36  
[TXT]ca.rmen.nounours_345.apk.verified.txt2017-05-07 13:49 36  
[TXT]ch.bailu.aat_16.apk.verified.txt2017-05-07 13:33 36  
[TXT]ch.bailu.aat_17.apk.verified.txt2017-05-07 13:33 36  
[TXT]ch.blinkenlights.android.vanilla_10460.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10470.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10480.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10490.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10500.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.blinkenlights.android.vanilla_10510.apk.verified.txt2017-05-07 13:32 36  
[TXT]ch.hgdev.toposuite_69.apk.verified.txt2017-05-07 13:28 36  
[TXT]ch.logixisland.anuto_9.apk.verified.txt2017-05-07 13:23 36  
[TXT]click.dummer.textthing_191.apk.verified.txt2017-05-07 13:17 36  
[TXT]click.dummer.textthing_192.apk.verified.txt2017-05-07 13:17 36  
[TXT]com.MarcosDiez.shareviahttp_25.apk.verified.txt2017-05-07 13:13 36  
[TXT]com.adam.aslfms_44.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.adonai.manman_162.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.agateau.catgenerator_2.apk.verified.txt2017-05-07 12:56 36  
[TXT]com.anddevw.getchromium_20170318.apk.verified.txt2017-05-07 12:41 36  
[TXT]com.android.music_2.apk.verified.txt2017-05-07 09:30 36  
[TXT]com.anysoftkeyboard.languagepack.basque_1.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.german_103.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.greek_200.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.hebrew_102.apk.verified.txt2017-05-07 09:14 36  
[TXT]com.anysoftkeyboard.languagepack.italian_100.apk.verified.txt2017-05-07 09:12 36  
[TXT]com.anysoftkeyboard.languagepack.latvian_100.apk.verified.txt2017-05-07 09:12 36  
[TXT]com.anysoftkeyboard.languagepack.neo_7.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.neo_8.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.norwegian_101.apk.verified.txt2017-05-07 09:11 36  
[TXT]com.anysoftkeyboard.languagepack.russian2_101.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.slovene_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.spain_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.swedish_103.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.tatar_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.anysoftkeyboard.languagepack.ukrainian_100.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.app.Zensuren_121.apk.verified.txt2017-05-07 09:10 36  
[TXT]com.arnaud.metronome_2.apk.verified.txt2017-05-07 09:07 36  
[TXT]com.byagowi.persiancalendar_522.apk.verified.txt2017-05-06 12:50 36  
[TXT]com.cgogolin.library_24.apk.verified.txt2017-05-06 12:47 36  
[TXT]com.cgogolin.library_27.apk.verified.txt2017-05-06 12:47 36  
[TXT]com.cityfreqs.littlesirecho_4.apk.verified.txt2017-05-06 10:11 36  
[TXT]com.commit451.gitlab_2040300.apk.verified.txt2017-05-06 10:02 36  
[TXT]com.coste.syncorg_10.apk.verified.txt2017-05-06 09:57 36  
[TXT]com.darshancomputing.BatteryIndicator.verified.txt2017-01-13 02:13 36  
[TXT]com.darshancomputing.BatteryIndicator_13018.apk.verified.txt2017-05-06 09:06 36  
[TXT]com.darshancomputing.BatteryIndicator_13022.apk.verified.txt2017-05-06 09:06 36  
[TXT]com.dftec.planetcon_13.apk.verified.txt2017-05-06 08:33 36  
[TXT]com.easwareapps.transparentwidget.verified.txt2017-01-13 01:12 36  
[TXT]com.easwareapps.transparentwidget_2.apk.verified.txt2017-05-06 07:41 36  
[TXT]com.ebaschiera.triplecamel_8.apk.verified.txt2017-05-06 07:40 36  
[TXT]com.eneko.hexcolortimewallpaper_2.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.earthquake.batterysimplysolid_12.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.earthquake_13.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.filemanager_5.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.enrico.sample_3.apk.verified.txt2017-05-06 07:18 36  
[TXT]com.fr3ts0n.stagefever_10009.apk.verified.txt2017-05-06 06:58 36  
[TXT]com.fsck.k9.material_24001.apk.verified.txt2017-05-06 06:55 36  
[TXT]com.futurice.android.reservator_17.apk.verified.txt2017-05-06 06:54 36  
[TXT]com.gcstar.viewer_14.apk.verified.txt2017-05-06 06:47 36  
[TXT]com.ghostsq.commander_317.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_318.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_322.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghostsq.commander_323.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.ghstudios.android.mhgendatabase_6.apk.verified.txt2017-05-06 06:31 36  
[TXT]com.github.sryze.wirebug.verified.txt2017-01-12 23:31 36  
[TXT]com.github.sryze.wirebug_101.apk.verified.txt2017-05-06 06:02 36  
[TXT]com.github.yeriomin.dumbphoneassistant_5.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.github.yeriomin.smsscheduler.verified.txt2017-01-12 23:30 36  
[TXT]com.github.yeriomin.smsscheduler_4.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.github.yeriomin.yalpstore_9.apk.verified.txt2017-05-06 06:01 36  
[TXT]com.greenaddress.abcore_54.apk.verified.txt2017-05-06 04:08 36  
[TXT]com.gunshippenguin.openflood_12.apk.verified.txt2017-05-06 04:06 36  
[TXT]com.haringeymobile.ukweather_27.apk.verified.txt2017-05-06 03:49 36  
[TXT]com.hayaisoftware.launcher.verified.txt2017-01-12 21:35 36  
[TXT]com.hayaisoftware.launcher_10404.apk.verified.txt2017-05-06 03:47 36  
[TXT]com.hayaisoftware.launcher_10405.apk.verified.txt2017-05-06 03:47 36  
[TXT]com.iazasoft.footguy_6.apk.verified.txt2017-05-06 03:38 36  
[TXT]com.ichi2.anki_20802300.apk.verified.txt2017-05-06 03:37 36  
[TXT]com.infonuascape.osrshelper_14.apk.verified.txt2017-05-06 03:35 36  
[TXT]com.iven.lfflfeedreader_63.apk.verified.txt2017-05-06 02:58 36  
[TXT]com.jarsilio.android.waveup_25.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jarsilio.android.waveup_26.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jarsilio.android.waveup_27.apk.verified.txt2017-05-06 02:53 36  
[TXT]com.jmstudios.redmoon_27.apk.verified.txt2017-05-06 02:45 36  
[TXT]com.jmstudios.redmoon_28.apk.verified.txt2017-05-06 02:45 36  
[TXT]com.kanedias.vanilla.coverfetch_3.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.kanedias.vanilla.lyrics_5.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.keylesspalace.tusky_5.apk.verified.txt2017-05-06 02:37 36  
[TXT]com.knirirr.beecount_117.apk.verified.txt2017-05-06 02:35 36  
[TXT]com.launcher.silverfish.verified.txt2017-01-12 20:24 36  
[TXT]com.launcher.silverfish_2.apk.verified.txt2017-05-06 02:30 36  
[TXT]com.llamacorp.equate_4.apk.verified.txt2017-05-06 01:21 36  
[TXT]com.llamacorp.equate_5.apk.verified.txt2017-05-06 01:21 36  
[TXT]com.mantz_it.rfanalyzer_1303.apk.verified.txt2017-05-06 00:57 36  
[TXT]com.mareksebera.simpledilbert.verified.txt2017-01-12 18:51 36  
[TXT]com.mareksebera.simpledilbert_36.apk.verified.txt2017-05-06 00:56 36  
[TXT]com.mareksebera.simpledilbert_37.apk.verified.txt2017-05-06 00:56 36  
[TXT]com.mikifus.padland_12.apk.verified.txt2017-05-06 00:08 36  
[TXT]com.miqote.shanawp_10.apk.verified.txt2017-05-06 00:06 36  
[TXT]com.mobilepearls.sokoban_14.apk.verified.txt2017-05-06 00:03 36  
[TXT]com.movim.movim_8.apk.verified.txt2017-05-05 22:40 36  
[TXT]com.mschlauch.comfortreader_6.apk.verified.txt2017-05-05 22:38 36  
[TXT]com.nltechno.dolidroidpro_28.apk.verified.txt2017-05-05 21:24 36  
[TXT]com.notecryptpro_18.apk.verified.txt2017-05-05 21:10 36  
[TXT]com.oakley.fon_152.apk.verified.txt2017-05-05 20:49 36  
[TXT]com.orgzly_58.apk.verified.txt2017-05-05 20:46 36  
[TXT]com.orpheusdroid.screenrecorder_13.apk.verified.txt2017-05-05 20:32 36  
[TXT]com.palliser.nztides_11.apk.verified.txt2017-05-05 20:30 36  
[TXT]com.philliphsu.clock2_113.apk.verified.txt2017-05-05 20:25 36  
[TXT]com.phpsysinfo_910.apk.verified.txt2017-05-05 20:24 36  
[TXT]com.prhlt.aemus.Read4SpeechExperiments_18.apk.verified.txt2017-05-05 19:51 36  
[TXT]com.quaap.launchtime_4.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.launchtime_51.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.launchtime_52.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.quaap.primary_3.apk.verified.txt2017-05-05 18:11 36  
[TXT]com.rastating.droidbeard_1502.apk.verified.txt2017-05-05 18:10 36  
[TXT]com.redirectapps.tvkill_20.apk.verified.txt2017-05-05 18:09 36  
[TXT]com.rubenwardy.minetestmodmanager_14.apk.verified.txt2017-05-05 18:03 36  
[TXT]com.samebits.beacon.locator_111.apk.verified.txt2017-05-05 17:17 36  
[TXT]com.seafile.seadroid2_65.apk.verified.txt2017-05-05 17:00 36  
[TXT]com.secuso.privacyFriendlyCodeScanner_9.apk.verified.txt2017-05-05 16:08 36  
[TXT]com.simplemobiletools.camera_32.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.flashlight_21.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.musicplayer_27.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.simplemobiletools.notes_28.apk.verified.txt2017-05-05 15:51 36  
[TXT]com.stoutner.privacybrowser.standard_18.apk.verified.txt2017-05-05 13:07 36  
[TXT]com.termux.api_13.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.styling_16.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.tasker_1.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.termux.widget_7.apk.verified.txt2017-05-05 12:13 36  
[TXT]com.ultramegatech.ey_28.apk.verified.txt2017-05-05 09:40 36  
[TXT]com.vrem.wifianalyzer_26.apk.verified.txt2017-05-05 08:45 36  
[TXT]com.wbrenna.gtfsoffline_10.apk.verified.txt2017-05-05 08:14 36  
[TXT]com.wmstein.transektcount_200.apk.verified.txt2017-05-05 08:02 36  
[TXT]com.wolas.awesomewallpaper.verified.txt2017-01-12 06:55 36  
[TXT]com.wolas.awesomewallpaper_1.apk.verified.txt2017-05-05 08:02 36  
[TXT]com.workingagenda.democracydroid_26.apk.verified.txt2017-05-05 08:01 36  
[TXT]com.workingagenda.democracydroid_28.apk.verified.txt2017-05-05 08:01 36  
[TXT]com.xargsgrep.portknocker_12.apk.verified.txt2017-05-05 07:58 36  
[TXT]com.yubico.yubioath_29.apk.verified.txt2017-05-05 07:38 36  
[TXT]cz.martykan.forecastie.verified.txt2017-01-12 05:09 36  
[TXT]cz.martykan.forecastie_13.apk.verified.txt2017-05-05 05:38 36  
[TXT]damo.three.ie_19.apk.verified.txt2017-05-05 05:37 36  
[TXT]de.arnowelzel.android.periodical_30.apk.verified.txt2017-05-05 05:27 36  
[TXT]de.audioattack.openlink_12.apk.verified.txt2017-05-05 05:27 36  
[TXT]de.baumann.browser_21.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.hhsmoodle_48.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.pdfcreator_12.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.pdfcreator_14.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.quitsmoking_11.apk.verified.txt2017-05-05 05:25 36  
[TXT]de.baumann.thema_39.apk.verified.txt2017-05-05 05:23 36  
[TXT]de.baumann.thema_40.apk.verified.txt2017-05-05 05:23 36  
[TXT]de.baumann.weather_34.apk.verified.txt2017-05-05 05:21 36  
[TXT]de.baumann.weather_36.apk.verified.txt2017-05-05 05:21 36  
[TXT]de.chaosdorf.meteroid.verified.txt2017-01-12 05:03 36  
[TXT]de.chaosdorf.meteroid_22.apk.verified.txt2017-05-05 05:17 36  
[TXT]de.cryptobitch.muelli.barcodegen_2.apk.verified.txt2017-05-05 05:16 36  
[TXT]de.dotwee.micropinner.verified.txt2017-01-12 04:48 36  
[TXT]de.dotwee.micropinner_24.apk.verified.txt2017-05-05 05:11 36  
[TXT]de.freewarepoint.whohasmystuff.verified.txt2017-01-12 04:45 36  
[TXT]de.freewarepoint.whohasmystuff_26.apk.verified.txt2017-05-05 03:49 36  
[TXT]de.grobox.blitzmail_12.apk.verified.txt2017-05-05 03:47 36  
[TXT]de.grobox.liberario_47.apk.verified.txt2017-05-05 03:47 36  
[TXT]de.hirtenstrasse.michael.lnkshortener_5.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.hoffmannsgimmickstaupunkt_16.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.j4velin.systemappmover_172.apk.verified.txt2017-05-05 03:46 36  
[TXT]de.jkliemann.parkendd_26.apk.verified.txt2017-05-05 03:41 36  
[TXT]de.k3b.android.androFotoFinder_24.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.k3b.android.androFotoFinder_26.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.k3b.android.androFotoFinder_28.apk.verified.txt2017-05-05 03:20 36  
[TXT]de.koelle.christian.trickytripper_21.apk.verified.txt2017-05-05 03:18 36  
[TXT]de.kromke.andreas.unpopmusicplayerfree_7.apk.verified.txt2017-05-05 03:18 36  
[TXT]de.mangelow.balance_3.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.debdroid_4.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.debdroid_5.apk.verified.txt2017-05-05 03:02 36  
[TXT]de.mangelow.slideitloud_7.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.mangelow.syncwifi_17.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.mangelow.throughput_15.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.markusfisch.android.shadereditor_29.apk.verified.txt2017-05-05 03:01 36  
[TXT]de.msal.muzei.nationalgeographic_9.apk.verified.txt2017-05-05 02:49 36  
[TXT]de.onyxbits.listmyapps.verified.txt2017-01-12 03:45 36  
[TXT]de.onyxbits.listmyapps_17.apk.verified.txt2017-05-05 02:10 36  
[TXT]de.quaddyservices.dynamicnightlight_2041.apk.verified.txt2017-05-05 01:35 36  
[TXT]de.reimardoeffinger.quickdic_82.apk.verified.txt2017-05-05 01:34 36  
[TXT]de.schildbach.wallet_298.apk.verified.txt2017-05-05 01:31 36  
[TXT]de.vibora.viborafeed_27.apk.verified.txt2017-05-05 01:04 36  
[TXT]de.xskat_14.apk.verified.txt2017-05-05 00:57 36  
[TXT]dk.jens.backup_19.apk.verified.txt2017-05-05 00:51 36  
[TXT]es.esy.CosyDVR_21.apk.verified.txt2017-05-05 00:12 36  
[TXT]es.esy.CosyDVR_22.apk.verified.txt2017-05-05 00:12 36  
[TXT]eu.flatworld.android.slider.verified.txt2017-01-12 01:54 36  
[TXT]eu.flatworld.android.slider_20301.apk.verified.txt2017-05-05 00:00 36  
[TXT]eu.polarclock_5.apk.verified.txt2017-05-04 22:08 36  
[TXT]eu.siacs.conversations_199.apk.verified.txt2017-05-04 22:00 36  
[TXT]eu.veldsoft.complica4.verified.txt2017-01-12 00:40 36  
[TXT]eu.veldsoft.complica4_4.apk.verified.txt2017-05-04 21:53 36  
[TXT]eu.veldsoft.ithaka.board.game.verified.txt2017-01-12 00:01 36  
[TXT]eu.veldsoft.ithaka.board.game_5.apk.verified.txt2017-05-04 21:14 36  
[TXT]eu.wikijourney.wikijourney_21.apk.verified.txt2017-05-11 09:51 36  
[TXT]felixwiemuth.lincal_9.apk.verified.txt2017-05-11 09:51 36  
[TXT]fly.speedmeter.grub_24.apk.verified.txt2017-05-11 09:48 36  
[TXT]fr.free.nrw.commons_60.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.gaulupeau.apps.InThePoche_31.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.gaulupeau.apps.InThePoche_32.apk.verified.txt2017-05-11 07:36 36  
[TXT]fr.herverenault.selfhostedgpstracker_13.apk.verified.txt2017-05-11 07:34 36  
[TXT]fr.kwiatkowski.ApkTrack_19.apk.verified.txt2017-05-11 07:29 36  
[TXT]fr.mobdev.goblim_7.apk.verified.txt2017-05-11 07:24 36  
[TXT]fr.neamar.kiss_92.apk.verified.txt2017-05-11 07:24 36  
[TXT]fr.unix_experience.owncloud_sms_45.apk.verified.txt2017-05-11 07:08 36  
[TXT]fr.xtof54.mousetodon_1.apk.verified.txt2017-05-11 07:07 36  
[TXT]free.rm.skytube.oss_5.apk.verified.txt2017-05-11 07:05 36  
[TXT]grmpl.mk.stepandheightcounter_5.apk.verified.txt2017-05-11 05:58 36  
[TXT]in.shick.diode_18.apk.verified.txt2017-05-11 05:36 36  
[TXT]in.shick.diode_19.apk.verified.txt2017-05-11 05:36 36  
[TXT]info.guardianproject.checkey.verified.txt2017-01-11 19:47 36  
[TXT]info.guardianproject.checkey_101.apk.verified.txt2017-05-11 05:12 36  
[TXT]info.meoblast001.thugaim_1.apk.verified.txt2017-05-11 03:40 36  
[TXT]info.meoblast001.thugaim_2.apk.verified.txt2017-05-11 03:40 36  
[TXT]io.github.engsergiu.react_4.apk.verified.txt2017-05-11 02:46 36  
[TXT]io.github.fvasco.pinpoi_39.apk.verified.txt2017-05-11 02:46 36  
[TXT]io.github.lonamiwebs.klooni_400.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.lonamiwebs.klooni_500.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.lonamiwebs.stringlate_990.apk.verified.txt2017-05-11 02:43 36  
[TXT]io.github.tjg1.nori_9.apk.verified.txt2017-05-11 02:41 36  
[TXT]it.feio.android.omninotes.foss_230.apk.verified.txt2017-05-10 23:11 36  
[TXT]it.langolonerd.app_1.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.linuxday.torino_1.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.lucci.cm.greyscaletheme.verified.txt2017-01-11 17:28 36  
[TXT]it.lucci.cm.greyscaletheme_115.apk.verified.txt2017-05-10 23:10 36  
[TXT]it.reyboz.bustorino_21.apk.verified.txt2017-05-10 22:40 36  
[TXT]it.reyboz.bustorino_22.apk.verified.txt2017-05-10 22:40 36  
[TXT]jpf.android.magiadni_9.apk.verified.txt2017-05-10 19:52 36  
[TXT]jpf.android.magiadni_10.apk.verified.txt2017-05-10 19:52 36  
[TXT]kiwi.root.an2linuxclient_4.apk.verified.txt2017-05-10 19:45 36  
[TXT]me.danielbarnett.addresstogps.verified.txt2017-01-11 14:19 36  
[TXT]me.danielbarnett.addresstogps_14.apk.verified.txt2017-05-10 02:39 36  
[TXT]me.johnmh.boogdroid_14.apk.verified.txt2017-05-10 02:36 36  
[TXT]me.kuehle.carreport.verified.txt2017-01-11 14:17 36  
[TXT]me.kuehle.carreport_52.apk.verified.txt2017-05-10 02:36 36  
[TXT]me.sheimi.sgit_110.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.shrimadhavuk.numselapp.verified.txt2017-01-11 14:15 36  
[TXT]me.shrimadhavuk.numselapp_1.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.shrimadhavuk.watransmitter.verified.txt2017-01-11 14:15 36  
[TXT]me.shrimadhavuk.watransmitter_3.apk.verified.txt2017-05-10 02:35 36  
[TXT]me.zeeroooo.materialfb_42.apk.verified.txt2017-05-10 02:34 36  
[TXT]mobi.boilr.boilr_9.apk.verified.txt2017-05-10 02:25 36  
[TXT]moe.feng.nhentai_35.apk.verified.txt2017-05-10 02:18 36  
[TXT]name.seguri.android.getforegroundactivity_3.apk.verified.txt2017-05-10 02:04 36  
[TXT]net.bible.android.activity_216.apk.verified.txt2017-05-10 00:42 36  
[TXT]net.ddns.mlsoftlaberge.trycorder_513.apk.verified.txt2017-05-10 00:26 36  
[TXT]net.ddns.mlsoftlaberge.trycorder_518.apk.verified.txt2017-05-10 00:26 36  
[TXT]net.gaast.giggity_67.apk.verified.txt2017-05-10 00:22 36  
[TXT]net.kismetwireless.android.smarterwifimanager_85.apk.verified.txt2017-05-09 23:52 36  
[TXT]net.mabako.steamgifts_1005508.apk.verified.txt2017-05-09 23:49 36  
[TXT]net.mypapit.mobile.myposition_11.apk.verified.txt2017-05-09 22:42 36  
[TXT]net.pejici.summation_3.apk.verified.txt2017-05-15 14:37 36  
[TXT]net.sf.ethersynth_100.apk.verified.txt2017-05-15 13:59 36  
[TXT]net.sourceforge.solitaire_cg_610.apk.verified.txt2017-05-15 13:46 36  
[TXT]net.sourceforge.solitaire_cg_705.apk.verified.txt2017-05-15 13:46 36  
[TXT]net.sourceforge.solitaire_cg_710.apk.verified.txt2017-05-15 13:46 36  
[TXT]nitezh.ministock_68.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_733.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_734.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_735.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_740.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.asymmetrics.droidshows_741.apk.verified.txt2017-05-15 13:35 36  
[TXT]nl.implode.regenalarm_40101.apk.verified.txt2017-05-15 13:24 36  
[TXT]nl.mpcjanssen.simpletask_3055.apk.verified.txt2017-05-15 13:24 36  
[TXT]nl.yoerinijs.notebuddy_1.apk.verified.txt2017-05-15 13:21 36  
[TXT]nl.yoerinijs.notebuddy_4.apk.verified.txt2017-05-15 13:21 36  
[TXT]nl.yoerinijs.notebuddy_7.apk.verified.txt2017-05-15 13:21 36  
[TXT]nodomain.freeyourgadget.gadgetbridge_86.apk.verified.txt2017-05-15 13:21 36  
[TXT]org.andstatus.app_204.apk.verified.txt2017-05-15 12:15 36  
[TXT]org.asdtm.fas_3.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.asnelt.derandom_10.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.asteroidos.sync_3.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.aykit.MyOwnNotes_11.apk.verified.txt2017-05-15 12:02 36  
[TXT]org.bienvenidoainternet.app_12.apk.verified.txt2017-05-15 11:55 36  
[TXT]org.billthefarmer.crossword_102.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.currency_107.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.currency_108.apk.verified.txt2017-05-15 11:46 36  
[TXT]org.billthefarmer.scope_112.apk.verified.txt2017-05-15 11:33 36  
[TXT]org.billthefarmer.shorty_107.apk.verified.txt2017-05-15 11:32 36  
[TXT]org.billthefarmer.siggen_109.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.siggen_110.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.tuner_114.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.billthefarmer.tuner_116.apk.verified.txt2017-05-15 11:31 36  
[TXT]org.bitbatzen.wlanscanner_1.apk.verified.txt2017-05-15 11:30 36  
[TXT]org.domogik.domodroid13_32.apk.verified.txt2017-05-15 10:17 36  
[TXT]org.dyndns.sven_ola.debian_kit_6.apk.verified.txt2017-05-15 09:11 36  
[TXT]org.fastergps_14.apk.verified.txt2017-05-15 08:50 36  
[TXT]org.gateshipone.odyssey_16.apk.verified.txt2017-05-15 08:16 36  
[TXT]org.horaapps.leafpic_13.apk.verified.txt2017-05-15 07:37 36  
[TXT]org.hwyl.sexytopo_13.apk.verified.txt2017-05-15 07:37 36  
[TXT]org.icasdri.mather.verified.txt2017-01-11 03:05 36  
[TXT]org.icasdri.mather_203.apk.verified.txt2017-05-15 07:34 36  
[TXT]org.indywidualni.fblite_49.apk.verified.txt2017-05-15 07:31 36  
[TXT]org.jak_linux.dns66_9.apk.verified.txt2017-05-15 07:20 36  
[TXT]org.jfet.batsHIIT_6.apk.verified.txt2017-05-15 07:13 36  
[TXT]org.kde.kdeconnect_tp_1610.apk.verified.txt2017-05-15 07:02 36  
[TXT]org.legtux.m_316k.fortune_2.apk.verified.txt2017-05-15 06:59 36  
[TXT]org.liberty.android.fantastischmemo_223.apk.verified.txt2017-05-15 06:58 36  
[TXT]org.libreoffice.impressremote_19.apk.verified.txt2017-05-15 06:57 36  
[TXT]org.ligi.fast.verified.txt2017-01-11 02:38 36  
[TXT]org.ligi.fast_65.apk.verified.txt2017-05-15 06:54 36  
[TXT]org.ligi.fast_66.apk.verified.txt2017-05-15 06:54 36  
[TXT]org.ligi.ipfsdroid.verified.txt2017-01-11 02:37 36  
[TXT]org.ligi.ipfsdroid_7.apk.verified.txt2017-05-15 06:53 36  
[TXT]org.ligi.scr_31.apk.verified.txt2017-05-15 06:49 36  
[TXT]org.mcxa.zephyrlogger_1.apk.verified.txt2017-05-15 06:27 36  
[TXT]org.microg.nlp.backend.nominatim_20039.apk.verified.txt2017-05-15 06:25 36  
[TXT]org.ntpsync_12.apk.verified.txt2017-05-15 05:52 36  
[TXT]org.ocsinventoryng.android.agent_24.apk.verified.txt2017-05-15 05:49 36  
[TXT]org.openbmap.unifiedNlp_18.apk.verified.txt2017-05-15 05:28 36  
[TXT]org.openintents.flashlight_10015.apk.verified.txt2017-05-15 05:25 36  
[TXT]org.openintents.notepad_10084.apk.verified.txt2017-05-15 05:24 36  
[TXT]org.polaric.cyanogenmodchangelog_66.apk.verified.txt2017-05-15 04:49 36  
[TXT]org.pulpdust.lesserpad_38.apk.verified.txt2017-05-15 04:44 36  
[TXT]org.scoutant.blokish_19.apk.verified.txt2017-05-15 02:32 36  
[TXT]org.secuso.privacyfriendlyactivitytracker_5.apk.verified.txt2017-05-15 02:32 36  
[TXT]org.secuso.privacyfriendlynetmonitor_3.apk.verified.txt2017-05-15 02:30 36  
[TXT]org.secuso.privacyfriendlyruler_3.apk.verified.txt2017-05-15 02:28 36  
[TXT]org.sensors2.osc_2.apk.verified.txt2017-05-15 02:22 36  
[TXT]org.sensors2.pd_1.apk.verified.txt2017-05-15 02:22 36  
[TXT]org.sufficientlysecure.ical_56.apk.verified.txt2017-05-15 00:49 36  
[TXT]org.toulibre.capitoledulibre_10.apk.verified.txt2017-05-14 22:24 36  
[TXT]org.transdroid.search_30.apk.verified.txt2017-05-14 22:20 36  
[TXT]org.us.andriod_4.apk.verified.txt2017-05-14 19:51 36  
[TXT]org.voidsink.anewjkuapp_140053.apk.verified.txt2017-05-14 19:50 36  
[TXT]org.whitequark.sipcaller_1.apk.verified.txt2017-05-14 19:25 36  
[TXT]org.wikipedia_191.apk.verified.txt2017-05-14 19:19 36  
[TXT]org.xbmc.kore_15.apk.verified.txt2017-05-14 18:17 36  
[TXT]org.y20k.trackbook_8.apk.verified.txt2017-05-14 17:55 36  
[TXT]org.y20k.transistor_34.apk.verified.txt2017-05-14 17:55 36  
[TXT]org.zephyrsoft.checknetwork_5.apk.verified.txt2017-05-14 17:51 36  
[TXT]pk.contender.earmouse.verified.txt2017-01-10 17:37 36  
[TXT]pk.contender.earmouse_27.apk.verified.txt2017-05-14 17:48 36  
[TXT]player.efis.pfd_3.apk.verified.txt2017-05-14 16:34 36  
[TXT]player.efis.pfd_7.apk.verified.txt2017-05-14 16:34 36  
[TXT]ro.ciubex.dscautorename_90.apk.verified.txt2017-05-14 16:28 36  
[TXT]ryey.camcov_9.apk.verified.txt2017-05-14 02:35 36  
[TXT]se.anyro.nfc_reader_14.apk.verified.txt2017-05-14 02:34 36  
[TXT]se.anyro.nfc_reader_15.apk.verified.txt2017-05-14 02:34 36  
[TXT]streetwalrus.usbmountr_2.apk.verified.txt2017-05-14 01:30 36  
[TXT]streetwalrus.usbmountr_3.apk.verified.txt2017-05-14 01:30 36  
[TXT]swati4star.createpdf_1.apk.verified.txt2017-05-14 01:29 36  
[TXT]tf.nox.wifisetup_20160804.apk.verified.txt2017-05-14 01:24 36  
[TXT]tk.jordynsmediagroup.simpleirc.fdroid_19.apk.verified.txt2017-05-14 01:24 36  
[TXT]tkj.android.homecontrol.mythmote.verified.txt2017-01-10 12:48 36  
[TXT]tkj.android.homecontrol.mythmote_2908.apk.verified.txt2017-05-14 01:24 36  
[TXT]uk.co.ashtonbrsc.android.intentintercept.verified.txt2017-01-10 12:39 36  
[TXT]uk.co.ashtonbrsc.android.intentintercept_224.apk.verified.txt2017-05-14 01:15 36  
[TXT]uk.co.yahoo.p1rpp.calendartrigger_1.apk.verified.txt2017-05-14 00:25 36  
[TXT]us.lindanrandy.cidrcalculator.verified.txt2017-01-10 12:11 36  
[TXT]us.lindanrandy.cidrcalculator_125.apk.verified.txt2017-05-14 00:20 36  
[TXT]x653.bullseye_1.apk.verified.txt2017-05-14 00:19 36  
[TXT]za.co.lukestonehm.logicaldefence_20.apk.verified.txt2017-05-14 00:13 36  
[   ]An.stop.json2022-11-24 15:31 79  
[   ]ai.susi.json2022-11-24 15:38 79  
[   ]com.olam.json2022-11-22 08:55 79  
[   ]fr.seeks.json2022-11-20 02:57 79  
[   ]com.iyps.json2022-11-23 00:56 80  
[   ]org.tint.json2022-11-26 01:49 80  
[   ]app.intra.json2022-11-24 15:16 81  
[   ]com.glTron.json2022-11-23 05:23 81  
[   ]com.log28.json2022-11-22 18:31 81  
[   ]ir.hsn6.tpb.json2022-11-19 14:51 81  
[   ]jp.yhonda.json2022-11-19 08:48 81  
[   ]org.btcmap.json2022-11-17 16:09 81  
[   ]ryey.flock.json2022-11-25 14:39 81  
[   ]taco.scoop.json2022-11-25 12:14 81  
[   ]com.atr.hiit.json2022-11-24 06:48 82  
[   ]de.sigfood.json2022-11-20 19:48 82  
[   ]fm.a2d.sf.json2022-11-20 07:20 82  
[   ]fr.asterope.json2022-11-20 07:03 82  
[   ]io.neurolab.json2022-11-19 15:37 82  
[   ]me.lucky.red.json2022-11-18 20:51 82  
[   ]me.writeily.json2022-11-18 20:03 82  
[   ]org.basic.lg.json2022-11-17 17:14 82  
[   ]org.simlar.json2022-11-16 05:34 82  
[   ]org.tasks.json2022-11-26 03:38 82  
[   ]ryey.camcov.json2022-11-25 14:45 82  
[   ]search.searx.json2022-11-25 14:37 82  
[   ]ch.citux.td.json2022-11-24 11:56 83  
[   ]com.deva.knot.json2022-11-23 17:21 83  
[   ]com.ogsdroid.json2022-11-22 08:58 83  
[   ]com.passcard.json2022-11-22 07:54 83  
[   ]com.polipoid.json2022-11-22 06:26 83  
[   ]eu.dfdx.jslab.json2022-11-20 11:11 83  
[   ]fr.syncarnet.json2022-11-20 02:52 83  
[   ]goo.TeaTimer.json2022-11-20 01:14 83  
[   ]me.lucky.wyfy.json2022-11-18 20:51 83  
[   ]org.jsl.shmp.json2022-11-17 06:50 83  
[   ]org.musicpd.json2022-11-16 21:27 83  
[   ]org.ntpsync.json2022-11-16 20:34 83  
[   ]org.sudowars.json2022-11-26 04:31 83  
[   ]rak.pixellwp.json2022-11-25 16:50 83  
[   ]budo.budoist.json2021-02-27 14:18 84  
[   ]com.ath0.rpn.json2022-11-24 06:48 84  
[   ]com.meteocool.json2022-11-22 15:49 84  
[   ]com.otago.open.json2022-11-22 08:33 84  
[   ]com.pindroid.json2022-11-22 07:09 84  
[   ]com.termux.gui.json2022-11-21 22:31 84  
[   ]eu.polarclock.json2022-11-20 10:04 84  
[   ]freemap.hikar.json2022-11-20 06:47 84  
[   ]inc.flide.vim8.json2022-11-19 22:50 84  
[   ]io.mrarm.irc.json2022-11-19 15:46 84  
[   ]me.lucky.vibe.json2022-11-18 20:51 84  
[   ]org.asdtm.fas.json2022-11-17 18:15 84  
[   ]org.ligi.scr.json2022-11-17 04:39 84  
[   ]org.og8.a1tox.json2022-11-16 20:23 84  
[   ]org.tomdroid.json2022-11-26 01:22 84  
[   ]ro.mihai.tpt.json2022-11-25 16:38 84  
[   ]security.pEp.json2022-04-01 17:16 84  
[   ]sun.bob.leela.json2022-11-25 13:01 84  
[   ]tof.cv.mpp.json2022-11-25 11:48 84  
[   ]atm.nasaimages.json2022-11-24 13:53 85  
[   ]br.odb.knights.json2022-11-24 13:11 85  
[   ]com.aa.mynotes.json2022-11-24 09:57 85  
[   ]com.colnix.fta.json2022-11-23 19:59 85  
[   ]com.ei.bmicalc.json2022-11-23 15:29 85  
[   ]com.evilinsult.json2022-11-23 13:31 85  
[   ]com.fullscreen.json2022-11-23 11:21 85  
[   ]com.icebem.akt.json2022-11-23 02:21 85  
[   ]com.mlkyh.hertz.json2022-11-22 15:19 85  
[   ]com.termux.boot.json2022-11-21 22:31 85  
[   ]com.u2fa.secur.json2022-11-21 19:36 85  
[   ]com.u17od.upm.json2021-03-09 01:05 85  
[   ]cos.premy.mines.json2022-11-21 13:35 85  
[   ]cri.sanity.json2022-11-21 13:33 85  
[   ]csci567.squeez.json2022-11-21 13:11 85  
[   ]damo.three.ie.json2022-11-21 08:11 85  
[   ]de.asmw.flindex.json2022-11-21 08:04 85  
[   ]de.bwl.lfdi.app.json2022-11-21 05:30 85  
[   ]de.jdsoft.law.json2022-11-21 01:35 85  
[   ]de.tadris.flang.json2022-11-20 17:57 85  
[   ]de.we.acaldav.json2022-11-20 14:26 85  
[   ]douzifly.list.json2022-11-20 12:39 85  
[   ]dubrowgn.wattz.json2022-11-20 12:37 85  
[   ]dudeofx.eval.json2022-11-20 12:37 85  
[   ]eu.ryuu.screeps.json2022-11-20 08:56 85  
[   ]gal.sli.singal.json2022-11-20 02:19 85  
[   ]hans.b.skewy1_0.json2022-11-20 01:05 85  
[   ]it.ecosw.dudo.json2022-11-19 12:07 85  
[   ]me.lucky.aodify.json2022-11-18 20:52 85  
[   ]ohm.quickdice.json2022-11-17 21:05 85  
[   ]om.sstvencoder.json2022-11-17 21:04 85  
[   ]org.droidupnp.json2022-11-17 13:10 85  
[   ]org.fastergps.json2022-11-17 12:27 85  
[   ]org.ironrabbit.json2022-11-17 07:45 85  
[   ]org.ligi.fast.json2022-11-17 05:12 85  
[   ]org.uaraven.e.json2022-11-25 23:23 85  
[   ]org.us.andriod.json2022-11-25 23:10 85  
[   ]org.vono.narau.json2022-11-25 22:14 85  
[   ]pro.dbro.bart.json2022-11-25 17:25 85  
[   ]ru.valle.btc.json2022-11-25 14:58 85  
[   ]space.bm835.pb.json2022-11-25 13:12 85  
[   ]tuioDroid.impl.json2022-11-25 11:08 85  
[   ]xdsopl.robot36.json2022-11-25 09:21 85  
[   ]ch.fixme.cowsay.json2022-11-24 11:47 86  
[   ]co.loubo.icicle.json2022-11-24 09:59 86  
[   ]com.blippex.app.json2022-11-24 00:26 86  
[   ]com.chess.clock.json2022-11-23 20:43 86  
[   ]com.corona_info.json2021-03-10 05:55 86  
[   ]com.geoquizfoss.json2022-11-23 10:37 86  
[   ]com.lligainterm.json2022-11-22 18:43 86  
[   ]com.politedroid.json2022-11-22 06:25 86  
[   ]com.sinpo.xnfc.json2022-11-21 23:54 86  
[   ]com.tss.android.json2022-11-21 20:47 86  
[   ]com.xinto.mauth.json2022-11-21 15:19 86  
[   ]com.yasfa.views.json2022-11-21 15:17 86  
[   ]de.csicar.ning.json2022-11-21 04:57 86  
[   ]de.hskl.contacts.json2022-11-21 01:49 86  
[   ]de.jepfa.bdt.json2022-11-21 01:25 86  
[   ]de.tui.itlogger.json2022-11-20 16:27 86  
[   ]hsware.HSTempo.json2022-11-20 00:46 86  
[   ]indrora.atomic.json2022-11-19 22:50 86  
[   ]it.faerb.crond.json2022-11-19 11:56 86  
[   ]libretasks.app.json2022-11-19 07:29 86  
[   ]lu.fisch.canze.json2022-11-19 07:10 86  
[   ]me.cgarcia.yarr.json2022-11-18 21:19 86  
[   ]me.lucky.catcher.json2022-11-18 20:52 86  
[   ]me.lucky.clipeus.json2022-11-18 20:52 86  
[   ]me.lucky.reactor.json2022-11-18 20:52 86  
[   ]naman14.timber.json2022-11-18 18:13 86  
[   ]net.ser1.forage.json2022-11-18 00:42 86  
[   ]org.ligi.ajsha.json2022-11-17 05:19 86  
[   ]org.ligi.faster.json2022-11-17 05:12 86  
[   ]org.macno.puma.json2022-11-17 02:19 86  
[   ]org.schabi.kiba.json2022-11-16 08:00 86  
[   ]org.windvolt.json2022-11-25 21:28 86  
[   ]sh.ikl.liteshort.json2022-11-25 13:53 86  
[   ]souch.smsbypass.json2022-11-25 13:13 86  
[   ]wiseguys.radar.json2022-11-25 09:43 86  
[   ]at.h4x.amsprung.json2022-11-24 13:59 87  
[   ]com.aragaer.jtt.json2022-11-24 06:56 87  
[   ]com.asdoi.mebis.json2022-11-24 06:52 87  
[   ]com.aurora.corona.json2022-11-24 06:46 87  
[   ]com.cax.pmk.ext.json2022-11-23 22:19 87  
[   ]com.cg.lrceditor.json2022-11-23 22:08 87  
[   ]com.cr5315.cfdc.json2022-11-23 19:40 87  
[   ]com.doomy.torch.json2022-11-23 16:45 87  
[   ]com.example.TTime.json2022-11-23 13:01 87  
[   ]com.gaurav.avnc.json2022-11-23 11:15 87  
[   ]com.isdp.trirose.json2022-11-23 01:09 87  
[   ]com.kaeruct.glxy.json2022-11-22 22:50 87  
[   ]com.lako.moclock.json2022-11-22 21:18 87  
[   ]com.matt.outfield.json2022-11-22 16:30 87  
[   ]com.oakley.fon.json2022-11-22 09:27 87  
[   ]com.phikal.regex.json2022-11-22 07:27 87  
[   ]com.phpsysinfo.json2022-11-22 07:24 87  
[   ]com.ruesga.rview.json2022-11-22 03:49 87  
[   ]com.sweak.qralarm.json2022-11-21 23:14 87  
[   ]com.tuyafeng.watt.json2022-11-21 19:47 87  
[   ]com.vwp.locdemo.json2022-11-21 16:54 87  
[   ]de.baswil.gctools.json2022-11-21 07:47 87  
[   ]de.monocles.mail.json2022-11-20 21:51 87  
[   ]dev.pesic.rpncalc.json2022-11-20 14:30 87  
[   ]edu.rit.csh.devin.json2022-11-20 11:48 87  
[   ]et.nWifiManager.json2022-11-20 11:16 87  
[   ]eu.veldsoft.kechi.json2022-11-20 08:02 87  
[   ]fr.s3i.pointeuse.json2022-11-20 02:59 87  
[   ]gal.sli.digalnet.json2022-11-20 02:19 87  
[   ]hu.vsza.adsdroid.json2022-11-20 00:38 87  
[   ]jp.forkhub.json2022-11-19 09:02 87  
[   ]max.music_cyclon.json2022-11-19 06:56 87  
[   ]me.sheimi.sgit.json2022-11-18 20:32 87  
[   ]mobi.boilr.boilr.json2022-11-18 19:05 87  
[   ]mobi.meddle.wehe.json2022-11-18 18:50 87  
[   ]net.fercanet.LNM.json2022-11-18 12:03 87  
[   ]net.frju.verdure.json2022-03-20 16:10 87  
[   ]net.glsk.wpgen.json2022-11-18 11:55 87  
[   ]net.oschina.app.json2022-11-18 09:11 87  
[   ]ooo.akito.webmon.json2022-11-17 20:30 87  
[   ]org.akvo.rsr.up.json2022-11-17 19:31 87  
[   ]org.decsync.flym.json2022-11-17 14:29 87  
[   ]org.ebur.debitum.json2022-11-17 12:56 87  
[   ]org.fdroid.nearby.json2022-11-17 12:01 87  
[   ]org.me.tvhguide.json2022-11-17 01:21 87  
[   ]org.tint.adblock.json2022-11-26 01:45 87  
[   ]org.toulibre.cdl.json2022-11-26 00:18 87  
[   ]ovh.ice.icecons.json2022-11-25 19:47 87  
[   ]pl.nkg.geokrety.json2022-11-25 17:37 87  
[   ]ryey.colorsniffer.json2022-11-25 14:44 87  
[   ]tk.superl2.xwifi.json2022-11-25 11:50 87  
[   ]town.robin.toadua.json2022-11-25 11:29 87  
[   ]aarddict.android.json2022-11-24 15:51 88  
[   ]am.zoom.mbrowser.json2022-11-24 15:33 88  
[   ]am.zoom.mlauncher.json2022-11-24 15:33 88  
[   ]amirz.dngprocessor.json2022-11-24 15:33 88  
[   ]atitel.com.todoer.json2022-11-24 13:58 88  
[   ]by.yauhenl.gardine.json2022-11-24 13:06 88  
[   ]ca.fuwafuwa.kaku.json2022-11-24 13:04 88  
[   ]ch.seto.kanjirecog.json2022-11-24 10:42 88  
[   ]com.GTP.eveminer.json2022-11-23 04:14 88  
[   ]com.abitsinc.andr.json2022-11-24 09:36 88  
[   ]com.andrew.apollo.json2022-11-24 09:00 88  
[   ]com.android.music.json2022-11-24 07:56 88  
[   ]com.android.quake.json2022-11-24 07:56 88  
[   ]com.best.deskclock.json2022-11-24 01:39 88  
[   ]com.catalin.rivia.json2022-11-23 22:21 88  
[   ]com.dwak.lastcall.json2022-11-23 15:48 88  
[   ]com.flasskamp.subz.json2022-11-23 12:32 88  
[   ]com.gravityplay.json2022-11-23 04:18 88  
[   ]com.grocerymanager.json2022-11-23 04:15 88  
[   ]com.gyorog.polycal.json2022-11-23 04:00 88  
[   ]com.hasi.hasid00r.json2022-11-23 03:13 88  
[   ]com.ilm.sandwich.json2022-11-23 02:13 88  
[   ]com.james.status.json2022-11-23 00:55 88  
[   ]com.matoski.adbm.json2022-11-22 16:32 88  
[   ]com.miqote.brswp.json2022-11-22 15:42 88  
[   ]com.piratebayfree.json2022-11-22 07:08 88  
[   ]com.platypus.SAnd.json2022-11-22 06:41 88  
[   ]com.plexer0.nitter.json2022-11-22 06:40 88  
[   ]com.ringdroid.json2022-11-22 04:15 88  
[   ]com.rj.pixelesque.json2022-11-22 04:15 88  
[   ]com.series.anlight.json2022-11-22 01:33 88  
[   ]com.ten15.diyfish.json2022-11-21 22:43 88  
[   ]com.utyf.pmetro.json2022-11-21 18:07 88  
[   ]com.vedroid.events.json2022-11-21 17:41 88  
[   ]com.volosyukivan.json2022-11-21 17:06 88  
[   ]com.wentam.defcol.json2022-11-21 16:20 88  
[   ]cxa.gridwallpaper.json2022-11-21 08:39 88  
[   ]cz.harvie.northdog.json2022-11-21 08:32 88  
[   ]cz.hejl.chesswalk.json2022-11-21 08:32 88  
[   ]de.dm1ri.totalog.json2022-11-21 03:45 88  
[   ]de.kodejak.hashr.json2022-11-21 00:41 88  
[   ]de.monocles.social.json2022-11-20 21:48 88  
[   ]dmusiolik.pijaret.json2022-11-20 12:42 88  
[   ]eu.quelltext.gita.json2022-11-20 09:01 88  
[   ]eun.initialvolume.json2022-11-20 10:06 88  
[   ]fr.miximum.napply.json2022-11-20 04:02 88  
[   ]fr.renzo.wikipoff.json2022-11-20 03:07 88  
[   ]freemap.opentrail.json2022-11-20 06:47 88  
[   ]giraffine.dimmer.json2022-11-20 02:08 88  
[   ]git.rrgb.kinolog.json2022-11-20 01:46 88  
[   ]gr.ndre.scuttloid.json2022-11-20 01:05 88  
[   ]ir.mrahimy.conceal.json2022-11-19 14:51 88  
[   ]me.anuraag.grader.json2022-11-18 23:08 88  
[   ]me.ocv.partyup.json2022-11-18 20:34 88  
[   ]net.scintill.duotp.json2022-11-18 00:42 88  
[   ]net.sf.crypt.gort.json2022-11-18 00:40 88  
[   ]net.tevp.postcode.json2022-11-17 22:56 88  
[   ]org.baitmooth.snow.json2022-11-17 17:15 88  
[   ]org.bc_bd.mrwhite.json2022-11-17 17:12 88  
[   ]org.calantas.mygeo.json2022-11-17 16:08 88  
[   ]org.jfet.batsHIIT.json2022-11-17 06:54 88  
[   ]org.ncrmnt.nettts.json2022-11-16 21:25 88  
[   ]org.oxycblt.auxio.json2022-11-16 16:14 88  
[   ]org.schabi.stethox.json2022-11-16 07:28 88  
[   ]org.t2.synconwifi.json2022-11-26 03:40 88  
[   ]org.zakky.memopad.json2022-11-25 20:18 88  
[   ]pl.lebihan.network.json2022-11-25 19:12 88  
[   ]pl.librus.client.json2022-11-25 19:12 88  
[   ]raele.concurseiro.json2022-11-25 16:53 88  
[   ]ru.natsuru.websdr.json2022-11-25 15:13 88  
[   ]se.norenh.rkfread.json2022-11-25 13:57 88  
[   ]sk.vx.connectbot.json2022-11-25 13:17 88  
[   ]us.feras.mdv.demo.json2022-11-25 09:48 88  
[   ]x653.all_in_gold.json2022-11-25 09:24 88  
[   ]app.weatheroverview.json2022-11-24 14:56 89  
[   ]at.bitfire.cadroid.json2022-11-24 14:43 89  
[   ]awais.instagrabber.json2022-11-24 13:31 89  
[   ]be.norio.randomapp.json2022-11-24 13:20 89  
[   ]bluepie.ad_silence.json2022-11-24 13:13 89  
[   ]com.abast.homebot.json2022-11-24 09:54 89  
[   ]com.app.Zensuren.json2022-11-24 06:57 89  
[   ]com.arduia.expense.json2022-11-24 06:56 89  
[   ]com.boardgamegeek.json2022-11-24 00:05 89  
[   ]com.bobek.metronome.json2022-11-23 23:53 89  
[   ]com.brackeys.ui.json2022-11-23 23:42 89  
[   ]com.chesire.pushie.json2022-11-23 20:43 89  
[   ]com.coste.syncorg.json2022-11-23 19:41 89  
[   ]com.dozuki.ifixit.json2022-11-23 16:10 89  
[   ]com.example.sshtry.json2022-11-23 13:13 89  
[   ]com.gcstar.viewer.json2022-11-23 11:13 89  
[   ]com.ginkel.hashit.json2022-11-23 10:12 89  
[   ]com.jmelzer.myttr.json2022-11-23 00:09 89  
[   ]com.m3sv.plainupnp.json2022-11-22 17:58 89  
[   ]com.manuelmaly.hn.json2022-11-22 16:57 89  
[   ]com.midisheetmusic.json2022-11-22 15:49 89  
[   ]com.mridang.speedo.json2022-11-22 14:28 89  
[   ]com.nkanaev.comics.json2021-03-09 10:01 89  
[   ]com.pi.attestation.json2022-11-22 07:18 89  
[   ]com.pilockerstable.json2022-11-22 07:16 89  
[   ]com.poinsart.votar.json2022-11-22 06:31 89  
[   ]com.simplytranslate.json2022-11-21 23:55 89  
[   ]com.stoptheballs.json2022-11-21 23:25 89  
[   ]com.thesis.yokatta.json2022-11-21 22:24 89  
[   ]com.tioui.opensound.json2022-11-21 22:13 89  
[   ]com.tmendes.dadosd.json2022-11-21 22:05 89  
[   ]com.turtleplayerv2.json2022-11-21 20:47 89  
[   ]cs4295.memecreator.json2022-11-21 13:29 89  
[   ]de.csicar.mensaplan.json2022-11-21 04:57 89  
[   ]de.cyberit.wasgeht.json2022-11-21 04:57 89  
[   ]de.perflyst.untis.json2022-11-20 21:26 89  
[   ]de.tcrass.minos.json2022-11-20 17:36 89  
[   ]de.toshsoft.tsvnc.json2022-11-20 16:49 89  
[   ]eu.tilk.cdlcplayer.json2022-11-20 08:26 89  
[   ]fr.byped.bwarearea.json2022-11-20 06:50 89  
[   ]fr.hnit.riverferry.json2022-11-20 04:19 89  
[   ]io.github.hasheazy.json2022-11-19 19:04 89  
[   ]io.github.saveastxt.json2022-11-19 17:38 89  
[   ]io.github.silinote.json2022-11-19 17:32 89  
[   ]io.github.x0b.rcx.json2022-11-19 16:27 89  
[   ]io.lbry.browser.json2022-11-19 15:51 89  
[   ]it.langolonerd.app.json2022-11-19 11:40 89  
[   ]it.linuxday.torino.json2022-11-19 11:39 89  
[   ]jp.muo.syncmemories.json2022-11-19 08:57 89  
[   ]jp.takke.cpustats.json2022-11-19 08:50 89  
[   ]koeln.mop.elpeefpe.json2022-11-19 08:30 89  
[   ]makeinfo.com.getid.json2022-11-19 07:05 89  
[   ]moe.dic1911.autodnd.json2022-11-18 18:49 89  
[   ]net.cyclestreets.json2022-11-18 12:27 89  
[   ]net.ibbaa.keepitup.json2022-11-18 11:22 89  
[   ]net.tapi.handynotes.json2022-11-17 22:56 89  
[   ]net.tjado.usbgadget.json2022-11-17 22:41 89  
[   ]org.aja.flightmode.json2022-11-17 19:31 89  
[   ]org.appsroid.fxpro.json2022-11-17 18:19 89  
[   ]org.balau.fakedawn.json2022-11-17 17:15 89  
[   ]org.brightdv.boxbox.json2022-11-17 16:11 89  
[   ]org.c_base.c_beam.json2022-11-17 16:01 89  
[   ]org.diygenomics.pg.json2022-11-17 13:26 89  
[   ]org.dpadgett.timer.json2022-11-17 13:16 89  
[   ]org.droidtr.termbin.json2022-11-17 13:10 89  
[   ]org.ethack.orwall.json2022-11-17 12:30 89  
[   ]org.example.rosary.json2022-11-17 12:28 89  
[   ]org.happysanta.gd.json2022-11-17 08:33 89  
[   ]org.ietf.ietfsched.json2022-11-17 07:55 89  
[   ]org.kristbaum.como.json2022-11-17 05:31 89  
[   ]org.ligi.fahrplan.json2022-11-17 05:14 89  
[   ]org.mcxa.softsound.json2022-11-17 01:25 89  
[   ]org.microg.nlp.json2022-11-17 00:53 89  
[   ]org.openlp.android.json2022-11-16 18:20 89  
[   ]org.pyneo.maps.json2022-11-16 13:43 89  
[   ]org.qii.weiciyuan.json2022-11-16 13:41 89  
[   ]org.sagemath.droid.json2022-11-16 08:05 89  
[   ]org.twelf.cmtheme.json2022-11-25 23:24 89  
[   ]ru.exlmoto.snood21.json2022-11-25 16:37 89  
[   ]site.xiaocao.pixiv.json2022-11-25 13:17 89  
[   ]steele.gerry.dotty.json2022-11-25 13:09 89  
[   ]szelok.app.twister.json2022-11-25 12:17 89  
[   ]timur.webrtc.check.json2022-11-25 11:51 89  
[   ]trikita.talalarmo.json2022-11-25 11:22 89  
[   ]x1125io.initdlight.json2022-11-25 09:25 89  
[   ]SpeedoMeterApp.main.json2022-11-25 13:10 90  
[   ]app.alextran.immich.json2022-11-24 15:29 90  
[   ]at.finderlein.noe.json2022-11-24 14:00 90  
[   ]ca.hamaluik.timecop.json2022-11-24 12:56 90  
[   ]ca.mimic.apphangar.json2022-11-24 12:56 90  
[   ]com.Pau.ImapNotes2.json2022-11-22 07:54 90  
[   ]com.amanoteam.unalix.json2022-11-24 09:02 90  
[   ]com.autismprime.fall.json2022-11-24 06:45 90  
[   ]com.chmod0.manpages.json2022-11-23 20:43 90  
[   ]com.cosmos.unreddit.json2022-11-23 19:41 90  
[   ]com.drodin.tuxrider.json2022-11-23 16:02 90  
[   ]com.f2prateek.dfg.json2021-03-10 00:53 90  
[   ]com.hermit.btreprap.json2022-11-23 02:43 90  
[   ]com.hexad.bluezime.json2022-11-23 02:42 90  
[   ]com.jiaqifeng.hacki.json2022-11-23 00:13 90  
[   ]com.juet.attendance.json2022-11-22 23:12 90  
[   ]com.ketanolab.nusimi.json2022-11-22 22:20 90  
[   ]com.klee.volumelockr.json2022-11-22 22:07 90  
[   ]com.kpstv.xclipper.json2022-11-22 21:55 90  
[   ]com.metallic.chiaki.json2022-11-22 15:49 90  
[   ]com.mhss.app.mybrain.json2022-11-22 15:49 90  
[   ]com.miqote.shanawp.json2022-11-22 15:42 90  
[   ]com.nexes.manager.json2022-11-22 13:35 90  
[   ]com.nextgis.mobile.json2022-11-22 12:01 90  
[   ]com.oF2pks.neolinker.json2022-11-22 08:58 90  
[   ]com.orphan.amplayer.json2022-11-22 08:37 90  
[   ]com.rohit2810.spotit.json2022-11-22 03:56 90  
[   ]com.sanskritbasics.json2022-11-22 02:48 90  
[   ]com.sound.ampache.json2022-11-21 23:45 90  
[   ]com.teleca.jamendo.json2022-11-21 22:50 90  
[   ]com.tjk104.openfndds.json2022-11-21 22:13 90  
[   ]com.tjm.stripepaper.json2022-11-21 22:13 90  
[   ]com.traffar.a24game.json2022-11-21 20:59 90  
[   ]com.traffar.pentago.json2022-11-21 20:52 90  
[   ]cxa.lineswallpaper.json2022-11-21 08:39 90  
[   ]cz.antecky.netswitch.json2022-11-21 08:38 90  
[   ]de.feisar.wordvalue.json2022-11-21 02:37 90  
[   ]de.k3b.android.calef.json2022-11-21 00:49 90  
[   ]de.mangelow.balance.json2022-11-20 23:09 90  
[   ]de.nico.ha_manager.json2022-11-20 21:39 90  
[   ]de.ph1b.audiobook.json2022-11-20 21:25 90  
[   ]de.steinpfeffer.rdt.json2022-11-20 19:26 90  
[   ]dev.melonpan.kotori.json2022-11-20 14:40 90  
[   ]eu.domob.anacam.json2022-11-20 11:11 90  
[   ]eu.veldsoft.scribe4.json2022-11-20 08:02 90  
[   ]fr.rhaz.ipfs.sweet.json2022-11-20 03:05 90  
[   ]in.tosc.remotedroid.json2022-11-19 21:01 90  
[   ]io.bmaupin.pitchpipe.json2022-11-19 20:46 90  
[   ]io.github.hopedia.json2022-11-19 19:02 90  
[   ]is.xyz.omw_nightly.json2022-11-19 13:26 90  
[   ]it.iiizio.epubator.json2022-11-19 11:43 90  
[   ]me.phh.superuser.json2022-11-18 20:34 90  
[   ]mobi.cyann.nstools.json2022-11-18 19:05 90  
[   ]net.asceai.meritous.json2022-11-18 13:00 90  
[   ]net.bluetoothviewer.json2022-11-18 12:33 90  
[   ]net.pejici.easydice.json2022-11-18 07:56 90  
[   ]net.sf.ethersynth.json2022-11-18 00:39 90  
[   ]org.addhen.smssync.json2022-03-19 23:32 90  
[   ]org.ligi.ipfsdroid.json2022-11-17 05:08 90  
[   ]org.openlp.android2.json2022-11-16 17:05 90  
[   ]org.piwigo.android.json2022-11-16 15:27 90  
[   ]org.shirakumo.ocelot.json2022-11-16 05:34 90  
[   ]org.wentura.getflow.json2022-11-25 21:56 90  
[   ]org.xapek.andiodine.json2022-11-25 21:09 90  
[   ]org.zimmob.zimlx.json2022-11-25 19:52 90  
[   ]press.condense.www.json2022-11-25 17:34 90  
[   ]ru.zxalexis.ugaday.json2022-11-25 14:45 90  
[   ]se.leap.riseupvpn.json2022-11-25 14:10 90  
[   ]simbio.se.nheengare.json2022-11-25 13:37 90  
[   ]za.co.neilson.alarm.json2022-11-25 08:54 90  
[   ]app.fedilab.mobilizon.json2022-11-24 15:28 91  
[   ]at.univie.sensorium.json2022-11-24 13:42 91  
[   ]be.geecko.QuickLyric.json2022-11-24 13:24 91  
[   ]buet.rafi.dictionary.json2022-11-24 13:08 91  
[   ]ca.ramzan.virtuosity.json2022-11-24 12:53 91  
[   ]cc.rainwave.android.json2022-11-24 12:33 91  
[   ]click.dummer.yidkey.json2022-11-24 10:25 91  
[   ]com.SecUpwN.AIMSICD.json2022-11-22 01:41 91  
[   ]com.a5corp.weather.json2022-11-24 09:58 91  
[   ]com.angryburg.uapp.json2022-11-24 07:52 91  
[   ]com.bec3.diolite.json2022-11-24 02:27 91  
[   ]com.berdik.macsposed.json2022-11-24 01:53 91  
[   ]com.blanyal.remindly.json2022-11-24 01:00 91  
[   ]com.cleveroad.sample.json2022-11-23 20:36 91  
[   ]com.code61.deadpixel.json2022-11-23 20:22 91  
[   ]com.dftec.planetcon.json2022-11-23 17:16 91  
[   ]com.dnielfe.manager.json2022-11-23 16:47 91  
[   ]com.easwareapps.g2l.json2022-11-23 15:46 91  
[   ]com.example.CosyDVR.json2022-11-23 13:29 91  
[   ]com.example.dozencalc.json2022-11-23 13:27 91  
[   ]com.example.openpass.json2022-11-23 13:16 91  
[   ]com.github.gotify.up.json2022-11-23 07:22 91  
[   ]com.github.libretube.json2022-11-23 07:16 91  
[   ]com.gladis.tictactoe.json2021-03-09 21:07 91  
[   ]com.glanznig.beepme.json2022-11-23 05:24 91  
[   ]com.gluege.nightlight.json2022-11-23 05:22 91  
[   ]com.horaapps.leafpic.json2022-11-23 02:39 91  
[   ]com.iazasoft.footguy.json2022-11-23 02:22 91  
[   ]com.inator.calculator.json2022-11-23 02:10 91  
[   ]com.infomaniak.meet.json2022-11-23 02:09 91  
[   ]com.jellyshack.block6.json2022-11-23 00:26 91  
[   ]com.jtechme.jumpgo.json2022-11-22 23:13 91  
[   ]com.junkfood.seal.json2022-11-22 22:51 91  
[   ]com.kaeruct.gotosleep.json2022-11-22 22:48 91  
[   ]com.kure.musicplayer.json2022-11-22 21:29 91  
[   ]com.libopenmw.openmw.json2022-11-22 20:06 91  
[   ]com.lun.chin.aicamera.json2022-11-22 18:02 91  
[   ]com.markusborg.test.json2022-11-22 16:49 91  
[   ]com.mridang.cellinfo.json2021-03-09 11:51 91  
[   ]com.mridang.throttle.json2022-11-22 14:26 91  
[   ]com.mridang.wifiinfo.json2021-03-09 11:46 91  
[   ]com.nathanatos.Cuppa.json2022-11-22 13:55 91  
[   ]com.nephoapp.anarxiv.json2022-11-22 13:49 91  
[   ]com.quaap.audiometer.json2022-11-22 05:44 91  
[   ]com.serwylo.babybook.json2022-11-22 01:33 91  
[   ]com.shadcat.secdroid.json2022-11-22 01:09 91  
[   ]com.team242.robozzle.json2022-11-21 22:51 91  
[   ]com.tomer.alwayson.json2022-11-21 21:14 91  
[   ]com.tomer.dbz.widget.json2022-11-21 21:13 91  
[   ]com.trisven.safenotes.json2022-11-21 20:49 91  
[   ]com.vlath.keyboard.json2022-11-21 17:11 91  
[   ]com.wrmndfzzy.atomize.json2022-11-21 15:50 91  
[   ]com.x1unix.s60icons.json2021-03-08 21:52 91  
[   ]com.xabber.android.json2022-11-21 15:50 91  
[   ]cx.vmx.sdcontacts.json2022-11-21 08:38 91  
[   ]de.beocode.bestbefore.json2022-11-21 06:59 91  
[   ]de.k4ever.k4android.json2022-11-21 00:45 91  
[   ]de.schlikk.calls.json2022-11-20 19:53 91  
[   ]de.thecode.lmd.json2022-11-20 17:11 91  
[   ]de.tum.in.tumcampus.json2022-11-20 15:33 91  
[   ]eu.devunit.fb_client.json2022-11-20 11:12 91  
[   ]eu.domob.bjtrainer.json2022-11-20 11:09 91  
[   ]eu.dorfbrunnen.momkin.json2022-11-20 11:09 91  
[   ]eu.quelltext.counting.json2022-11-20 09:01 91  
[   ]eu.veldsoft.tri.peaks.json2022-11-20 07:57 91  
[   ]fil.libre.repwifiapp.json2022-11-20 07:25 91  
[   ]fly.speedmeter.grub.json2022-11-20 07:20 91  
[   ]fr.keuse.rightsalert.json2022-11-20 04:11 91  
[   ]fr.masciulli.drinks.json2022-11-20 04:05 91  
[   ]fr.s13d.photobackup.json2022-11-20 03:01 91  
[   ]fr.twentynine.keepon.json2022-11-20 02:48 91  
[   ]free.rm.netcfgwidget.json2022-11-20 06:46 91  
[   ]home.jmstudios.calc.json2022-11-20 01:04 91  
[   ]im.vector.app.json2022-02-05 10:39 91  
[   ]in.digistorm.aksharam.json2022-11-19 22:50 91  
[   ]info.frangor.laicare.json2022-11-19 22:33 91  
[   ]io.github.folderlogs.json2022-11-19 19:56 91  
[   ]is.binary.alcoholnow.json2022-11-19 14:51 91  
[   ]jwtc.android.chess.json2022-11-19 08:44 91  
[   ]kr.hybdms.sidepanel.json2022-11-19 08:29 91  
[   ]me.johnmh.boogdroid.json2022-11-18 20:58 91  
[   ]me.mgerdes.open_golf.json2022-11-18 20:51 91  
[   ]ml.adamsprogs.bimba.json2022-11-18 19:49 91  
[   ]moe.martini.midictrl.json2022-11-18 18:44 91  
[   ]net.pejici.summation.json2022-11-18 02:19 91  
[   ]net.pherth.omnomagon.json2022-11-18 02:10 91  
[   ]net.phunehehe.foocam.json2022-11-18 01:33 91  
[   ]net.stkaddons.viewer.json2022-11-17 23:06 91  
[   ]net.sylvek.itracing2.json2022-11-17 23:04 91  
[   ]net.taler.merchantpos.json2022-11-17 23:01 91  
[   ]net.xzos.upgradeall.json2022-11-17 21:57 91  
[   ]org.biotstoiq.seshat.json2022-11-17 16:31 91  
[   ]org.birthdayadapter.json2022-11-17 16:31 91  
[   ]org.blockinger.game.json2022-11-17 16:25 91  
[   ]org.cuberite.android.json2022-11-17 14:47 91  
[   ]org.dgtale.icsimport.json2022-11-17 14:24 91  
[   ]org.dyndns.fules.ck.json2022-11-17 12:59 91  
[   ]org.froscon.schedule.json2022-11-17 10:49 91  
[   ]org.icasdri.mather.json2022-11-17 07:57 91  
[   ]org.ligi.blexplorer.json2022-11-17 05:16 91  
[   ]org.servalproject.json2022-11-16 05:58 91  
[   ]org.snikket.android.json2022-11-16 05:17 91  
[   ]org.thecongers.mtpms.json2022-11-26 02:04 91  
[   ]org.tw.onze.cmtheme.json2022-11-25 23:24 91  
[   ]org.xphnx.iconsubmit.json2022-11-25 20:39 91  
[   ]pl.hypeapp.endoscope.json2022-11-25 19:18 91  
[   ]pl.kuben.progressapp.json2022-11-25 19:16 91  
[   ]rasel.lunar.launcher.json2022-11-25 16:50 91  
[   ]re.indigo.epistolaire.json2022-11-25 16:50 91  
[   ]ru.evgeniy.dpitunnel.json2022-11-25 16:37 91  
[   ]ru.yourok.torrserve.json2022-11-25 14:45 91  
[   ]se.embargo.retroboy.json2022-11-25 14:33 91  
[   ]siir.es.adbWireless.json2022-11-25 13:53 91  
[   ]tube.chikichiki.sako.json2022-11-25 11:08 91  
[   ]aq.com.sharetobrowser.json2022-11-24 14:56 92  
[   ]at.tomtasche.reader.json2022-11-24 13:44 92  
[   ]au.com.darkside.xdemo.json2022-11-24 13:35 92  
[   ]axp.tool.apkextractor.json2022-11-24 13:29 92  
[   ]ca.andries.portknocker.json2022-11-24 13:06 92  
[   ]cat.pantsu.nyaapantsu.json2022-11-24 12:36 92  
[   ]cc.kafuu.bilidownload.json2022-11-24 12:33 92  
[   ]ch.corona.tracing.json2022-11-24 11:54 92  
[   ]ch.cryptobit.letterbox.json2022-11-24 11:49 92  
[   ]ch.ihdg.calendarcolor.json2022-11-24 11:45 92  
[   ]ch.thilojaeggi.notely.json2022-11-24 10:39 92  
[   ]cl.coders.faketraveler.json2022-11-24 10:34 92  
[   ]click.dummer.rickapp.json2022-11-24 10:30 92  
[   ]com.alexkang.bluechat.json2022-11-24 09:04 92  
[   ]com.alxgnon.postwriter.json2022-11-24 09:02 92  
[   ]com.android.launcher3.json2022-11-24 08:34 92  
[   ]com.appmindlab.nano.json2022-11-24 07:09 92  
[   ]com.bec3.mobilite.json2022-11-24 02:25 92  
[   ]com.biotstoiq.cryptix.json2022-11-24 01:11 92  
[   ]com.bleyl.recurrence.json2022-11-24 00:27 92  
[   ]com.bretternst.URLazy.json2022-11-23 23:00 92  
[   ]com.chooloo.www.koler.json2022-11-23 20:42 92  
[   ]com.color.colornamer.json2022-11-23 19:59 92  
[   ]com.cybrosys.palmcalc.json2022-11-23 18:46 92  
[   ]com.diblui.fullcolemak.json2022-11-23 17:15 92  
[   ]com.easwareapps.baria.json2022-11-23 15:48 92  
[   ]com.eventyay.attendee.json2022-11-23 13:33 92  
[   ]com.fediphoto.lineage.json2022-11-23 12:43 92  
[   ]com.github.igrmk.smsq.json2022-11-23 07:19 92  
[   ]com.grmasa.soundtoggle.json2022-11-23 04:15 92  
[   ]com.harr1424.listmaker.json2022-11-23 03:13 92  
[   ]com.invoiceninja.app.json2022-11-23 01:22 92  
[   ]com.irahul.worldclock.json2022-11-23 01:21 92  
[   ]com.jpwolfso.privdnsqt.json2022-11-22 23:16 92  
[   ]com.kaeruct.raumballer.json2022-11-22 22:48 92  
[   ]com.kolloware.wechange.json2022-11-22 21:55 92  
[   ]com.liato.bankdroid.json2022-11-22 20:10 92  
[   ]com.lyonbros.turtl.json2022-11-22 18:00 92  
[   ]com.mendhak.sheepyhorn.json2022-11-22 15:52 92  
[   ]com.merxury.blocker.json2022-11-22 15:49 92  
[   ]com.moonpi.tapunlock.json2022-11-22 14:55 92  
[   ]com.mustupid.metronome.json2022-11-22 14:09 92  
[   ]com.notriddle.budget.json2022-11-22 10:33 92  
[   ]com.phstudio.darktheme.json2022-11-22 07:23 92  
[   ]com.qubling.sidekick.json2021-03-09 06:33 92  
[   ]com.quchen.flashcard.json2022-11-22 05:25 92  
[   ]com.rareventure.gps2.json2022-11-22 05:01 92  
[   ]com.reecedunn.espeak.json2022-11-22 04:38 92  
[   ]com.rigid.birthdroid.json2022-11-22 04:17 92  
[   ]com.sahdeepsingh.Bop.json2022-11-22 03:49 92  
[   ]com.serwylo.msjviewer.json2022-11-22 01:24 92  
[   ]com.shapps.mintubeapp.json2022-11-22 01:06 92  
[   ]com.simonramstedt.yoke.json2022-11-22 00:56 92  
[   ]com.timvdalen.gizmooi.json2022-11-21 22:14 92  
[   ]com.winston69.simpill.json2022-11-21 16:17 92  
[   ]com.zzzmode.appopsx.json2022-11-21 13:36 92  
[   ]corewala.gemini.buran.json2022-11-21 13:35 92  
[   ]de.badaix.snapcast.json2022-11-21 08:03 92  
[   ]de.delusions.measure.json2022-11-21 04:07 92  
[   ]de.hfu.funfpunktnull.json2022-11-21 01:55 92  
[   ]de.hoffmannsgimmicks.json2022-11-21 01:50 92  
[   ]de.mangelow.syncwifi.json2022-11-20 23:08 92  
[   ]de.meonwax.soundboard.json2022-11-20 22:39 92  
[   ]de.nulide.bikecomputer.json2022-11-20 21:36 92  
[   ]de.vibora.viborafeed.json2022-11-20 15:09 92  
[   ]dev.danjackson.speaker.json2022-11-20 15:10 92  
[   ]dev.jtsalva.cloudmare.json2022-11-20 14:54 92  
[   ]dev.linwood.butterfly.json2022-11-20 14:53 92  
[   ]dev.marchello.sharik.json2022-11-20 14:46 92  
[   ]eu.droogers.smsmatrix.json2022-11-20 11:09 92  
[   ]eu.halaser.beamctrl.json2022-11-20 10:48 92  
[   ]eu.siebeck.sipswitch.json2022-11-20 08:28 92  
[   ]eu.veldsoft.brainstonz.json2022-11-20 08:14 92  
[   ]eu.veldsoft.vitoshadm.json2022-11-20 07:54 92  
[   ]eu.webdragon.storygame.json2022-11-20 07:53 92  
[   ]fr.bepo.clavierexterne.json2022-11-20 06:50 92  
[   ]github.yaa110.memento.json2022-11-20 02:04 92  
[   ]github.yaa110.piclice.json2022-11-20 02:03 92  
[   ]ie.defo.ech_apps.json2022-11-20 00:38 92  
[   ]info.aario.killcamera.json2022-11-19 22:46 92  
[   ]it.rgp.nyagua.pafcalc.json2022-11-19 09:58 92  
[   ]jackpal.droidexaminer.json2022-11-19 09:49 92  
[   ]kuesji.link_eye.fdroid.json2022-11-19 08:21 92  
[   ]me.bgregos.brighttask.json2022-11-18 22:59 92  
[   ]me.yardenac.comaphone.json2022-11-18 20:01 92  
[   ]mohammad.adib.roundr.json2022-11-18 18:41 92  
[   ]nds.fyll.puzzle_grid.json2022-11-18 17:39 92  
[   ]net.foucry.pilldroid.json2022-11-18 12:03 92  
[   ]net.gcompris.full.json2022-11-18 12:01 92  
[   ]net.vreeken.quickmsg.json2022-11-17 22:27 92  
[   ]one.librem.chat.json2022-11-17 21:04 92  
[   ]org.aykit.MyOwnNotes.json2022-11-17 17:16 92  
[   ]org.bibledit.android.json2022-11-17 17:10 92  
[   ]org.booncode.bluepass4.json2022-11-17 16:11 92  
[   ]org.chrisbailey.todo.json2022-11-17 15:57 92  
[   ]org.dynalogin.android.json2022-11-17 12:59 92  
[   ]org.eukalyptus.balance.json2022-11-17 12:28 92  
[   ]org.glucosio.android.json2022-11-17 10:06 92  
[   ]org.horaapps.leafpic.json2022-11-17 08:05 92  
[   ]org.itxtech.daedalus.json2022-11-17 07:08 92  
[   ]org.mcxa.zephyrlogger.json2022-11-17 01:22 92  
[   ]org.nv95.openmanga.json2022-11-16 20:23 92  
[   ]org.safecoin.safeprice.json2022-11-16 13:03 92  
[   ]org.systemcall.scores.json2022-11-26 03:40 92  
[   ]org.voidptr.swpieview.json2022-11-25 22:28 92  
[   ]org.yausername.dvd.json2022-11-25 20:31 92  
[   ]ru.equestriadev.mgke.json2022-04-01 21:04 92  
[   ]ru.henridellal.patolli.json2022-11-25 15:23 92  
[   ]ru.hugeping.reinstead.json2022-11-25 15:23 92  
[   ]ru.ttyh.neko259.notey.json2022-11-25 15:00 92  
[   ]se.johanhil.clipboard.json2022-11-25 14:32 92  
[   ]tech.techlore.plexus.json2022-11-25 12:08 92  
[   ]tk.al54.dev.badpixels.json2022-11-25 11:51 92  
[   ]top.fumiama.copymanga.json2022-11-25 11:29 92  
[   ]ua.gardenapple.trylbry.json2022-11-25 11:01 92  
[   ]us.spotco.ir_remote.json2022-11-25 09:47 92  
[   ]at.techbee.jtx.json2022-11-24 13:50 93  
[   ]cc.co.eurdev.urecorder.json2022-11-24 12:34 93  
[   ]ch.tiim.markdown_widget.json2022-11-24 10:36 93  
[   ]com.addismaptransit.app.json2022-11-24 09:35 93  
[   ]com.ancantus.HYPNOTOAD.json2022-11-24 09:01 93  
[   ]com.beem.project.beem.json2022-11-24 02:22 93  
[   ]com.brianco.colorclock.json2022-11-23 23:00 93  
[   ]com.ciarang.tallyphant.json2022-11-23 20:42 93  
[   ]com.csmarosi.wifiautoff.json2022-11-23 19:29 93  
[   ]com.doplgangr.secrecy.json2022-11-23 16:44 93  
[   ]com.easwareapps.quoter.json2022-11-23 15:44 93  
[   ]com.easytarget.micopi.json2022-11-23 15:35 93  
[   ]com.enrico.filemanager.json2022-11-23 14:33 93  
[   ]com.eolwral.osmonitor.json2022-11-23 14:26 93  
[   ]com.example.siete_media.json2022-11-23 13:15 93  
[   ]com.finnmglas.launcher.json2022-11-23 12:33 93  
[   ]com.flasskamp.energize.json2022-11-23 12:32 93  
[   ]com.hanntech.free2pass.json2022-11-23 03:53 93  
[   ]com.health.openworkout.json2022-11-23 02:44 93  
[   ]com.javierllorente.adc.json2022-11-23 00:34 93  
[   ]com.kazispin.money_logs.json2022-11-22 22:20 93  
[   ]com.luorrak.ouroboros.json2022-11-22 18:01 93  
[   ]com.moonpi.swiftnotes.json2022-11-22 14:55 93  
[   ]com.mustupid.pitch_pipe.json2022-11-22 14:09 93  
[   ]com.nbossard.packlist.json2022-11-22 13:54 93  
[   ]com.sagar.screenshift2.json2022-11-22 03:49 93  
[   ]com.secuso.torchlight2.json2022-11-22 01:37 93  
[   ]com.shurik.droidzebra.json2022-11-22 01:03 93  
[   ]com.sovworks.edslite.json2022-11-21 23:44 93  
[   ]com.soyblue.bluesound.json2022-11-21 23:42 93  
[   ]com.stonegate.tsacdop.json2022-11-21 23:34 93  
[   ]com.th.XenonWallpapers.json2022-11-21 22:16 93  
[   ]com.tmarki.comicmaker.json2022-11-21 22:11 93  
[   ]com.yubico.yubiclip.json2022-11-21 15:09 93  
[   ]de.com.quaap.primary.json2022-11-21 05:00 93  
[   ]de.deftk.openww.android.json2022-11-21 04:07 93  
[   ]de.digisocken.reotwe.json2022-11-21 03:47 93  
[   ]de.dotwee.micropinner.json2022-11-21 03:45 93  
[   ]de.pinyto.exalteddicer.json2022-11-20 21:19 93  
[   ]de.rmrf.partygames.json2022-11-20 20:33 93  
[   ]de.sensebox.blockly.json2022-11-20 19:53 93  
[   ]de.srlabs.snoopsnitch.json2022-11-20 19:28 93  
[   ]de.varengold.activeTAN.json2022-11-20 15:10 93  
[   ]edu.berkeley.boinc.json2022-11-20 12:13 93  
[   ]eu.dartstrainer.app.twa.json2022-11-20 11:14 93  
[   ]eu.pretix.pretixdroid.json2022-11-20 10:04 93  
[   ]eu.veldsoft.fish.rings.json2022-11-20 08:14 93  
[   ]fr.bux.rollingdashboard.json2022-11-20 06:50 93  
[   ]fr.xtof54.dragonGoApp.json2022-11-20 02:22 93  
[   ]helium314.localbackend.json2022-11-20 01:05 93  
[   ]im.vector.riotx.json2022-11-19 23:44 93  
[   ]io.dahliaos.calculator.json2022-11-19 20:46 93  
[   ]io.ente.photos.fdroid.json2022-11-19 20:46 93  
[   ]io.github.installalogs.json2022-11-19 19:01 93  
[   ]io.github.mthli.Ninja.json2022-11-19 18:38 93  
[   ]io.treehouses.remote.json2022-11-19 15:09 93  
[   ]julianwi.javainstaller.json2022-11-19 08:47 93  
[   ]kr.softgear.multiping.json2022-11-19 08:21 93  
[   ]m.co.rh.id.a_medic_log.json2022-11-18 23:30 93  
[   ]mixedbit.speechtrainer.json2022-11-18 19:52 93  
[   ]net.androidcomics.acv.json2022-11-18 17:23 93  
[   ]net.bmaron.openfixmap.json2022-11-18 12:32 93  
[   ]net.bytten.xkcdviewer.json2022-11-18 12:31 93  
[   ]net.chilon.matt.teacup.json2022-11-18 12:29 93  
[   ]net.daverix.urlforward.json2022-11-18 12:26 93  
[   ]net.mcarolan.whenzebus.json2022-11-18 10:47 93  
[   ]nya.kitsunyan.foxydroid.json2022-11-17 21:13 93  
[   ]org.alberto97.aodtoggle.json2022-11-17 19:30 93  
[   ]org.asdtm.goodweather.json2022-11-17 18:15 93  
[   ]org.ciasaboark.tacere.json2022-11-17 15:56 93  
[   ]org.durka.hallmonitor.json2022-11-17 13:06 93  
[   ]org.flyve.mdm.agent.json2022-11-17 11:49 93  
[   ]org.github.OxygenGuide.json2022-11-17 10:12 93  
[   ]org.irmacard.cardemu.json2022-11-17 07:53 93  
[   ]org.mazhuang.guanggoo.json2022-11-17 01:38 93  
[   ]org.opengemara.shiurim.json2022-11-16 20:11 93  
[   ]org.schabi.svgredirect.json2022-11-16 07:28 93  
[   ]ru.evgeniy.dpitunnelcli.json2022-11-25 16:37 93  
[   ]ru.henridellal.fsassist.json2022-11-25 15:24 93  
[   ]space.kraut.schluessel.json2022-11-25 13:11 93  
[   ]sushi.hardcore.droidfs.json2022-11-25 12:36 93  
[   ]systems.now8.app.json2022-11-25 12:23 93  
[   ]ut.ewh.audiometrytest.json2022-11-25 09:46 93  
[   ]agersant.polaris.json2022-11-24 15:38 94  
[   ]at.zweng.bankomatinfos.json2022-11-24 13:38 94  
[   ]audio.funkwhale.ffa.json2022-11-24 13:33 94  
[   ]br.usp.ime.retrobreaker.json2022-11-24 13:09 94  
[   ]com.abh80.smartedge.json2022-11-24 09:53 94  
[   ]com.actisec.clipcaster.json2022-11-24 09:36 94  
[   ]com.artifex.mupdfdemo.json2022-11-24 06:55 94  
[   ]com.enjoyingfoss.parlera.json2022-11-23 14:34 94  
[   ]com.eventyay.organizer.json2021-03-10 01:18 94  
[   ]com.example.deeplviewer.json2022-11-23 13:28 94  
[   ]com.example.dozenalclock.json2022-11-23 13:27 94  
[   ]com.example.poleidoscope.json2022-11-23 13:15 94  
[   ]com.foxykeep.lifecounter.json2021-03-10 00:30 94  
[   ]com.geecko.QuickLyric.json2022-11-23 11:13 94  
[   ]com.haha01haha01.harail.json2022-11-23 04:00 94  
[   ]com.jkcarino.ankieditor.json2022-11-23 00:10 94  
[   ]com.katiearose.sobriety.json2022-11-22 22:21 94  
[   ]com.lloydtorres.stately.json2022-11-22 18:31 94  
[   ]com.lucasdnd.bitclock16.json2022-11-22 18:10 94  
[   ]com.macpoule.plantsense.json2022-11-22 17:44 94  
[   ]com.matburt.mobileorg.json2022-11-22 16:44 94  
[   ]com.materialos.cm.theme.json2022-11-22 16:33 94  
[   ]com.money.manager.ex.json2021-03-09 12:42 94  
[   ]com.nanoconverter.zlab.json2022-11-22 13:57 94  
[   ]com.onest8.onetimepad.json2022-11-22 08:48 94  
[   ]com.philliphsu.clock2.json2022-11-22 07:26 94  
[   ]com.quaap.phonefonefun.json2022-11-22 05:27 94  
[   ]com.scraperclub.android.json2022-11-22 02:28 94  
[   ]com.sentienhq.launcher.json2022-11-22 01:33 94  
[   ]com.sirekanyan.knigopis.json2022-11-21 23:54 94  
[   ]com.syncedsynapse.kore2.json2022-11-21 23:14 94  
[   ]com.templaro.opsiz.aka.json2022-11-21 22:44 94  
[   ]com.truchsess.send2car.json2022-11-21 20:48 94  
[   ]com.tuntori.mightieramp.json2022-11-21 20:47 94  
[   ]com.umang.dashnotifier.json2022-11-21 19:12 94  
[   ]com.veken0m.bitcoinium.json2022-11-21 17:41 94  
[   ]com.wesaphzt.privatelock.json2022-11-21 16:19 94  
[   ]com.woefe.shoppinglist.json2022-11-21 15:57 94  
[   ]com.zfdang.touchhelper.json2022-11-21 14:56 94  
[   ]community.peers.license.json2022-11-22 14:12 94  
[   ]de.drmaxnix.futharkboard.json2022-11-21 03:18 94  
[   ]de.jurihock.voicesmith.json2022-11-21 01:03 94  
[   ]de.mangelow.slideitloud.json2022-11-20 23:08 94  
[   ]de.mangelow.throughput.json2022-11-20 23:08 94  
[   ]de.onyxbits.geobookmark.json2022-11-20 21:35 94  
[   ]de.westnordost.luftlinie.json2022-11-20 14:24 94  
[   ]dev.yasan.metro.fdroid.json2022-11-20 14:26 94  
[   ]eu.berdosi.app.heartbeat.json2022-11-20 11:14 94  
[   ]in.ac.dducollegedu.shell.json2022-11-19 23:32 94  
[   ]io.github.datastopwatch.json2022-11-19 20:21 94  
[   ]io.github.ismywebsiteup.json2022-11-19 19:01 94  
[   ]it.mn.salvi.linuxDayOSM.json2022-11-19 11:38 94  
[   ]jp.co.omronsoft.openwnn.json2022-11-19 09:13 94  
[   ]jp.ksksue.app.terminal.json2022-11-19 08:58 94  
[   ]krillefear.funwithkanji.json2022-11-19 08:22 94  
[   ]m.co.rh.id.a_flash_deck.json2022-11-18 23:30 94  
[   ]moe.lz233.unvcode.json2022-11-18 18:44 94  
[   ]name.lmj001.savetodevice.json2022-11-18 17:43 94  
[   ]net.czlee.debatekeeper.json2022-11-18 12:27 94  
[   ]net.gsantner.dandelior.json2022-11-18 11:54 94  
[   ]net.haltcondition.anode.json2022-11-18 11:24 94  
[   ]net.logomancy.diedroid.json2022-11-18 10:53 94  
[   ]net.solutinno.websearch.json2022-11-18 00:39 94  
[   ]net.sourceforge.andsys.json2022-11-18 00:21 94  
[   ]one.librem.tunnel.json2022-11-17 20:39 94  
[   ]org.aminb.mathtools.app.json2022-11-17 19:25 94  
[   ]org.berlin_vegan.bvapp.json2022-11-17 17:12 94  
[   ]org.biotstoiq.gophercle.json2022-11-17 16:31 94  
[   ]org.cipherdyne.fwknop2.json2022-11-17 15:51 94  
[   ]org.gnucash.android.json2022-11-17 10:04 94  
[   ]org.hiittimer.hiittimer.json2022-11-17 08:28 94  
[   ]org.holylobster.nuntius.json2022-11-17 08:06 94  
[   ]org.jschwab.openrecipes.json2022-11-17 06:50 94  
[   ]org.keyoxide.keyoxide.json2022-11-17 06:18 94  
[   ]org.libre.agosto.p2play.json2022-11-17 05:21 94  
[   ]org.ligi.satoshiproof.json2022-11-17 04:43 94  
[   ]org.sasehash.burgerwp.json2022-11-16 08:01 94  
[   ]org.segin.bfinterpreter.json2022-11-16 06:05 94  
[   ]org.sixgun.ponyexpress.json2022-11-16 05:24 94  
[   ]org.tamanegi.atmosphere.json2022-11-26 03:38 94  
[   ]org.tvheadend.tvhguide.json2022-11-25 23:27 94  
[   ]org.wikilovesmonuments.json2022-11-25 21:45 94  
[   ]org.witness.sscphase1.json2022-11-25 21:28 94  
[   ]org.wordpress.android.json2022-11-25 21:18 94  
[   ]pl.ascendit.onetimealarm.json2022-11-25 19:42 94  
[   ]pro.oneredpixel.l9droid.json2022-11-25 17:22 94  
[   ]protect.gift_card_guard.json2022-11-25 17:02 94  
[   ]sony.hidden.servicemenu.json2022-11-25 13:15 94  
[   ]tf.nox.wifisetup.json2022-11-25 11:53 94  
[   ]z4pp3r.flashlightwidget.json2022-11-25 08:56 94  
[   ]am.ed.exportcontacts.json2022-11-24 15:34 95  
[   ]asgardius.page.s3manager.json2022-11-24 14:43 95  
[   ]at.zweng.bankomatinfos2.json2022-11-24 13:36 95  
[   ]au.com.darkside.XServer.json2022-11-24 13:35 95  
[   ]be.humanoids.webthingify.json2022-11-24 13:22 95  
[   ]biz.codefuture.svgviewer.json2022-11-24 13:14 95  
[   ]br.com.dgimenes.nasapic.json2022-11-24 13:13 95  
[   ]co.epitre.aelf_lectures.json2022-11-24 10:07 95  
[   ]com.alexcruz.papuhwalls.json2022-11-24 09:21 95  
[   ]com.blntsoft.emailpopup.json2022-11-24 00:16 95  
[   ]com.bmpak.anagramsolver.json2022-11-24 00:07 95  
[   ]com.brapeba.roaminginfo.json2022-11-23 23:42 95  
[   ]com.brucelet.spacetrader.json2022-11-23 22:45 95  
[   ]com.carriez.flutter_hbb.json2022-11-23 22:24 95  
[   ]com.chesire.nekome.json2022-11-23 20:43 95  
[   ]com.claha.showtimeremote.json2022-11-23 20:37 95  
[   ]com.cradle.iitc_mobile.json2022-11-23 19:39 95  
[   ]com.dconstructing.cooper.json2022-11-23 17:26 95  
[   ]com.elementlo.spark_list.json2022-11-23 15:28 95  
[   ]com.emmanuelmess.itsdicey.json2022-11-23 14:36 95  
[   ]com.florianthaler.githo.json2022-11-23 12:32 95  
[   ]com.fproject.cryptolitycs.json2022-11-23 11:55 95  
[   ]com.gimranov.zandy.app.json2022-11-23 10:12 95  
[   ]com.gitea.theoden8.sudaku.json2022-11-23 10:11 95  
[   ]com.goltzkiste.guessaday.json2022-11-23 05:12 95  
[   ]com.googlecode.gtalksms.json2022-11-23 04:44 95  
[   ]com.hearham.repeaterstart.json2021-03-13 12:46 95  
[   ]com.joshtwigg.cmus.droid.json2022-11-22 23:28 95  
[   ]com.kn.paper_foss_theme.json2022-11-22 21:57 95  
[   ]com.machiav3lli.fdroid.json2022-11-22 17:50 95  
[   ]com.msapps.touchdetector.json2022-11-22 14:26 95  
[   ]com.namelessdev.mpdroid.json2022-11-22 14:06 95  
[   ]com.niparasc.papanikolis.json2022-11-22 11:42 95  
[   ]com.noahjutz.gymroutines.json2022-11-22 11:38 95  
[   ]com.quaap.dodatheexploda.json2022-11-22 05:37 95  
[   ]com.redblaster.hsl.main.json2022-11-22 04:41 95  
[   ]com.roozbehzarei.filester.json2022-11-22 03:56 95  
[   ]com.rouzbehzarei.filester.json2022-11-22 03:56 95  
[   ]com.rubenroy.minimaltodo.json2022-11-22 03:55 95  
[   ]com.samarthdesai.repeatme.json2022-11-22 03:44 95  
[   ]com.smorgasbork.hotdeath.json2022-11-21 23:45 95  
[   ]com.tobykurien.batteryfu.json2022-11-21 21:59 95  
[   ]com.tomer.poke.notifier.json2022-11-21 21:11 95  
[   ]com.traffar.game_of_life.json2022-11-21 20:54 95  
[   ]com.tughi.aggregator.json2022-11-21 20:47 95  
[   ]com.vuze.android.remote.json2022-11-21 16:56 95  
[   ]com.wbrenna.gtfsoffline.json2022-11-21 16:22 95  
[   ]com.weskenyon.bookmarkos.json2022-11-21 16:19 95  
[   ]com.xenris.liquidwarsos.json2022-11-21 15:20 95  
[   ]com.zegoggles.smssync.json2021-03-08 20:19 95  
[   ]de.benibela.videlibri.json2022-11-21 07:02 95  
[   ]de.mathfactory.mooltifill.json2022-11-20 22:53 95  
[   ]de.onyxbits.pocketbandit.json2022-11-20 21:31 95  
[   ]de.piratentools.spickerrr.json2022-11-20 21:18 95  
[   ]de.rochefort.childmonitor.json2022-11-20 20:28 95  
[   ]dev.jmoore.lametricnotify.json2022-11-20 14:54 95  
[   ]dev.obfusk.jiten.json2022-11-20 14:40 95  
[   ]dev.ukanth.ufirewall.json2022-11-20 14:30 95  
[   ]dk.meznik.jan.encrypttext.json2022-11-20 12:42 95  
[   ]eu.veldsoft.free.klondike.json2022-11-20 08:08 95  
[   ]in.umairkhan.remotedroid.json2022-11-19 20:54 95  
[   ]io.github.baiatbun.react.json2022-11-19 20:46 95  
[   ]jp.sfjp.webglmol.NDKmol.json2022-11-19 08:51 95  
[   ]lanchon.sigspoof.checker.json2022-11-19 07:30 95  
[   ]net.micode.soundrecorder.json2022-11-18 10:40 95  
[   ]net.osmand.parkingPlugin.json2022-11-18 08:25 95  
[   ]net.redsolver.noteless.json2022-11-18 01:14 95  
[   ]org.androidsoft.coloring.json2022-11-17 18:54 95  
[   ]org.calyxinstitute.vpn.json2022-11-17 16:08 95  
[   ]org.ddosolitary.okcagent.json2022-11-17 14:41 95  
[   ]org.fossasia.openevent.json2022-11-17 11:45 95  
[   ]org.jamienicol.episodes.json2022-11-17 07:00 95  
[   ]org.openttd.fdroid.json2022-11-16 16:41 95  
[   ]org.purplei2p.i2pd.json2022-11-16 14:10 95  
[   ]org.quovadit.apps.andof.json2022-11-16 13:10 95  
[   ]org.redcross.openmapkit.json2022-11-16 13:09 95  
[   ]org.schabi.terminightor.json2022-11-16 07:26 95  
[   ]org.smblott.intentradio.json2022-11-16 05:21 95  
[   ]org.sparkleshare.android.json2022-11-16 05:01 95  
[   ]org.whitequark.sipcaller.json2022-11-25 21:45 95  
[   ]rino.org.tethercompanion.json2022-11-25 16:50 95  
[   ]ro.hume.cosmin.retrostack.json2022-11-25 16:44 95  
[   ]ru.neverdark.silentnight.json2022-11-25 15:11 95  
[   ]space.neothefox.laytray.json2022-11-25 13:11 95  
[   ]tk.giesecke.painlessmesh.json2022-11-25 11:51 95  
[   ]tw.qtlin.mac.airunlocker.json2022-11-25 11:07 95  
[   ]akk.astro.droid.moonphase.json2022-11-24 15:34 96  
[   ]app.tice.TICE.production.json2022-11-24 14:56 96  
[   ]byrne.utilities.converter.json2022-11-24 13:06 96  
[   ]com.FireFart.Permissions2.json2022-11-23 12:33 96  
[   ]com.aliernfrog.LacMapTool.json2022-11-24 09:03 96  
[   ]com.altillimity.satpredict.json2022-11-24 09:02 96  
[   ]com.android2.calculator3.json2022-11-24 08:50 96  
[   ]com.artivain.reseaudiscord.json2022-11-24 06:52 96  
[   ]com.berdik.letmedowngrade.json2022-11-24 01:56 96  
[   ]com.bri1.soundbored.reborn.json2022-11-23 23:00 96  
[   ]com.commonslab.commonslab.json2022-11-23 19:51 96  
[   ]com.dfzlv.gjjlt.caramelos.json2022-11-23 17:16 96  
[   ]com.ecuamobi.deckwallet.json2022-11-23 15:33 96  
[   ]com.emmanuelmess.tictactoe.json2022-11-23 14:35 96  
[   ]com.example.booklistingapk.json2022-11-23 13:29 96  
[   ]com.frrahat.quransimple.json2022-11-23 11:37 96  
[   ]com.ghostsq.commander.smb.json2022-11-23 10:20 96  
[   ]com.github.dawidd6.andttt.json2022-11-23 08:06 96  
[   ]com.github.egonw.isotopes.json2022-11-23 07:37 96  
[   ]com.github.xloem.qrstream.json2022-11-23 05:42 96  
[   ]com.googlecode.gogodroid.json2022-11-23 04:49 96  
[   ]com.icechen1.notable.pro.json2022-11-23 02:21 96  
[   ]com.invano.ambientweather.json2022-11-23 01:32 96  
[   ]com.ivanovsky.passnotes.json2022-11-23 01:04 96  
[   ]com.jeffliu.balancetheball.json2022-11-23 00:33 96  
[   ]com.jim.sharetocomputer.json2022-11-23 00:13 96  
[   ]com.jotabout.screeninfo.json2022-11-22 23:21 96  
[   ]com.kokkle.gamevirusattack.json2022-11-22 21:56 96  
[   ]com.miqote.angelplayerwp.json2022-11-22 15:42 96  
[   ]com.mishiranu.dashchan.json2022-11-22 15:41 96  
[   ]com.mobile.bummerzaehler.json2022-11-22 15:19 96  
[   ]com.mobilepearls.sokoban.json2022-11-22 15:19 96  
[   ]com.morlunk.mumbleclient.json2022-11-22 14:40 96  
[   ]com.neumorphic.calculator.json2022-11-22 13:42 96  
[   ]com.nickspatties.timeclock.json2022-11-22 11:54 96  
[   ]com.simplecity.amp_pro.json2021-03-13 14:40 96  
[   ]com.sunilpaulmathew.snotz.json2022-11-21 23:20 96  
[   ]com.svenjacobs.app.leon.json2022-11-21 23:16 96  
[   ]com.tastycactus.timesheet.json2022-11-21 22:52 96  
[   ]com.trianguloy.urlchecker.json2022-11-21 20:49 96  
[   ]com.tttdevs.stncbookmarks.json2022-11-21 20:47 96  
[   ]com.tunjid.fingergestures.json2021-03-09 01:23 96  
[   ]com.unicornsonlsd.finamp.json2022-11-21 18:34 96  
[   ]com.unwind.networkmonitor.json2022-11-21 18:32 96  
[   ]com.watabou.pixeldungeon.json2022-11-21 16:43 96  
[   ]com.workingagenda.fissure.json2022-11-21 15:53 96  
[   ]com.yakovlevegor.DroidRec.json2022-11-21 15:17 96  
[   ]community.fairphone.clock.json2022-11-22 14:17 96  
[   ]cx.mccormick.pddroidparty.json2022-11-21 08:39 96  
[   ]cz.eutopia.snooperstopper.json2022-11-21 08:34 96  
[   ]cz.vitSkalicky.klavesnice.json2022-11-21 08:12 96  
[   ]de.beowulf.libretranslater.json2022-11-21 06:59 96  
[   ]de.jugendhacker.xmppadmin.json2022-11-21 01:04 96  
[   ]de.measite.contactmerger.json2022-11-20 22:44 96  
[   ]de.onyxbits.photobookmark.json2022-11-20 21:33 96  
[   ]de.onyxbits.sensorreadout.json2022-11-20 21:27 96  
[   ]de.sesu8642.feudaltactics.json2022-11-20 19:53 96  
[   ]de.skubware.opentraining.json2022-11-20 19:44 96  
[   ]dev.atajan.lingva_android.json2022-11-20 15:10 96  
[   ]dev.danjackson.noisecancel.json2022-11-20 15:10 96  
[   ]dk.andsen.asqlitemanager.json2022-11-20 12:57 96  
[   ]edu.cmu.pocketsphinx.demo.json2022-11-20 11:58 96  
[   ]edu.killerud.kitchentimer.json2022-11-20 11:49 96  
[   ]eu.veldsoft.house.of.cards.json2022-11-20 08:08 96  
[   ]fi.bitrite.android.ws.json2022-11-20 07:31 96  
[   ]fr.ybo.transportsrennes.json2022-11-20 02:19 96  
[   ]info.puzz.a10000sentences.json2022-11-19 21:43 96  
[   ]io.github.engsergiu.react.json2022-11-19 20:08 96  
[   ]io.github.randomfilemaker.json2022-11-19 17:39 96  
[   ]me.anuraag.loveactualized.json2022-11-18 23:07 96  
[   ]name.soulayrol.rhaa.sholi.json2022-11-18 17:41 96  
[   ]net.etuldan.sparss.floss.json2022-11-18 12:16 96  
[   ]net.kervala.comicsreader.json2022-11-18 11:11 96  
[   ]net.syntaxblitz.plucklock.json2022-11-17 23:01 96  
[   ]network.mysterium.vpn.json2022-11-17 21:59 96  
[   ]np.com.binabh.basedcooking.json2022-11-17 21:17 96  
[   ]onlymash.flexbooru.play.json2022-11-17 20:30 96  
[   ]org.billthefarmer.print.json2022-11-17 16:42 96  
[   ]org.cimbar.camerafilecopy.json2022-11-17 15:54 96  
[   ]org.katsarov.heatcalc.json2022-11-17 06:49 96  
[   ]org.legtux.m_316k.fortune.json2022-11-17 05:26 96  
[   ]org.moparisthebest.appbak.json2022-11-17 00:12 96  
[   ]org.ndeftools.boilerplate.json2022-11-16 21:24 96  
[   ]org.savapage.android.print.json2022-11-16 08:00 96  
[   ]org.woheller69.lavatories.json2022-11-25 21:26 96  
[   ]org.yuttadhammo.tipitaka.json2022-11-25 20:28 96  
[   ]pro.rudloff.muzei.commons.json2022-11-25 17:21 96  
[   ]ru.glesik.nostrangersms.json2022-11-25 15:26 96  
[   ]ru.ifproject.android.afr.json2022-11-25 15:21 96  
[   ]saschpe.contactevents.json2022-11-25 14:39 96  
[   ]systems.byteswap.aiproute.json2022-11-25 12:24 96  
[   ]uk.ac.swansea.eduroamcat.json2022-11-25 11:01 96  
[   ]ymakei.vegetarian_journal.json2022-11-25 08:56 96  
[   ]be.uhasselt.privacypolice.json2022-11-24 13:15 97  
[   ]cn.ac.lz233.tarnhelm.json2022-11-24 10:24 97  
[   ]com.Sommerlichter.social.json2022-11-21 23:45 97  
[   ]com.abhinavmarwaha.curator.json2022-11-24 09:48 97  
[   ]com.amabyte.vtucslabmanual.json2022-11-24 09:02 97  
[   ]com.atharok.barcodescanner.json2022-11-24 06:48 97  
[   ]com.bikodbg.sharetopinboard.json2022-11-24 01:11 97  
[   ]com.boztalay.puppyframeuid.json2022-11-23 23:44 97  
[   ]com.dimension.tessercube.json2022-11-23 17:14 97  
[   ]com.dirkgassen.wator.json2022-11-23 17:04 97  
[   ]com.dragons.aurora.json2022-11-23 16:05 97  
[   ]com.github.howeyc.crocgui.json2022-11-23 07:21 97  
[   ]com.google.android.gms.json2022-11-23 05:07 97  
[   ]com.google.code.apps2org.json2022-11-23 04:59 97  
[   ]com.halftough.webcomreader.json2022-11-23 03:59 97  
[   ]com.iamtrk.androidexplorer.json2022-11-23 02:23 97  
[   ]com.isanexusdev.androidcpg.json2022-11-23 01:10 97  
[   ]com.leestarb.fourthtools.json2022-11-22 20:36 97  
[   ]com.mantz_it.rfanalyzer.json2022-11-22 16:57 97  
[   ]com.murrayc.galaxyzoo.app.json2022-11-22 14:11 97  
[   ]com.nathanosman.chronosnap.json2022-11-22 13:55 97  
[   ]com.nephi.getoffyourphone.json2022-11-22 13:50 97  
[   ]com.nishantboro.splititeasy.json2022-11-22 11:39 97  
[   ]com.nitish.privacyindicator.json2022-11-22 11:39 97  
[   ]com.omegavesko.holocounter.json2022-11-22 08:51 97  
[   ]com.omegavesko.sutransplus.json2022-11-22 08:51 97  
[   ]com.openpi.spellingwizard.json2022-11-22 08:47 97  
[   ]com.pavelsof.wormhole.json2022-11-22 07:52 97  
[   ]com.pluscubed.matloglibre.json2022-11-22 06:40 97  
[   ]com.sandeel.bushidoblocks.json2022-11-22 02:51 97  
[   ]com.sensirion.smartgadget.json2022-11-22 01:34 97  
[   ]com.simplytranslate_mobile.json2022-11-21 23:55 97  
[   ]com.thechiefmeat.freetusky.json2022-11-21 22:27 97  
[   ]com.tomaszmarzeion.notepad.json2022-11-21 21:19 97  
[   ]com.trianguloy.adnihilation.json2022-11-21 20:49 97  
[   ]com.twistedplane.sealnote.json2022-11-21 19:47 97  
[   ]com.zachrattner.pockettalk.json2022-11-21 15:08 97  
[   ]covidsecure.uk.venuecheckin.json2022-11-21 13:33 97  
[   ]de.digisocken.stop_o_moto.json2022-11-21 03:46 97  
[   ]de.grobox.appbundlereporter.json2022-11-21 02:06 97  
[   ]de.k3b.android.camerafolder.json2022-11-21 00:49 97  
[   ]de.onyxbits.remotekeyboard.json2022-11-20 21:27 97  
[   ]de.sirjofri.fingerlist.json2022-11-20 19:44 97  
[   ]de.spiritcroc.riotx.json2021-03-13 16:29 97  
[   ]digital.selfdefense.lucia.json2022-11-20 12:57 97  
[   ]fi.harism.wallpaper.flier.json2022-11-20 07:28 97  
[   ]info.aario.mywifipasswords.json2022-11-19 22:45 97  
[   ]info.plateaukao.einkbro.json2022-11-19 21:43 97  
[   ]it.angrydroids.epub3reader.json2022-11-19 13:00 97  
[   ]jonas.tool.saveForOffline.json2022-11-19 09:43 97  
[   ]m.co.rh.id.a_personal_stuff.json2022-11-18 23:22 97  
[   ]mkg20001.net.samremote.json2022-11-18 19:50 97  
[   ]name.myigel.fahrplan.eh17.json2022-11-18 17:43 97  
[   ]net.alegen.android.netclip.json2022-11-18 17:24 97  
[   ]net.basov.lws.qr.fdroid.json2022-11-18 12:56 97  
[   ]net.somethingdreadful.MAL.json2022-11-18 00:36 97  
[   ]one.librem.social.multi.json2022-11-17 20:49 97  
[   ]org.avmedia.remotevideocam.json2022-11-17 17:16 97  
[   ]org.chickenhook.binderfuzzy.json2022-11-17 15:57 97  
[   ]org.emergent.android.weave.json2022-11-17 12:41 97  
[   ]org.jfo.app.makesomenoise.json2022-11-17 06:54 97  
[   ]org.nexttracks.android.json2022-11-16 21:22 97  
[   ]org.passwordmaker.android.json2022-11-16 15:50 97  
[   ]org.safermobile.intheclear.json2022-11-16 13:03 97  
[   ]org.sge.haltestellenanzeige.json2022-11-16 05:48 97  
[   ]ru.gelin.android.sendtosd.json2022-11-25 16:37 97  
[   ]ru.nsu.bobrofon.easysshfs.json2022-11-25 15:10 97  
[   ]screen.dimmer.pixelfilter.json2022-11-25 14:38 97  
[   ]se.tube42.kidsmem.android.json2022-11-25 13:57 97  
[   ]software.mdev.bookstracker.json2022-11-25 13:15 97  
[   ]tk.giesecke.disaster_radio.json2022-11-25 11:51 97  
[   ]yellr.net.yellr_android.json2022-11-25 08:57 97  
[   ]app.shosetsu.android.fdroid.json2022-11-24 14:56 98  
[   ]be.brunoparmentier.apkshare.json2022-11-24 13:29 98  
[   ]br.com.frs.foodrestrictions.json2022-11-24 13:11 98  
[   ]ch.thgoebel.spartathlonapp.json2022-11-24 10:42 98  
[   ]click.dummer.have_radiosion.json2022-11-24 10:33 98  
[   ]com.achep.widget.jellyclock.json2022-11-24 09:36 98  
[   ]com.autismprime.krassesSpiel.json2022-11-24 06:45 98  
[   ]com.bmco.cratesiounofficial.json2022-11-24 00:07 98  
[   ]com.chanapps.four.activity.json2022-11-23 22:07 98  
[   ]com.cityfreqs.littlesirecho.json2022-11-23 20:41 98  
[   ]com.corvettecole.gotosleep.json2022-11-23 19:42 98  
[   ]com.danielkim.soundrecorder.json2022-11-23 18:16 98  
[   ]com.derek_s.hubble_gallery.json2022-11-23 17:24 98  
[   ]com.dimowner.audiorecorder.json2022-11-23 17:04 98  
[   ]com.dozingcatsoftware.dodge.json2022-11-23 16:17 98  
[   ]com.evancharlton.mileage.json2022-11-23 13:41 98  
[   ]com.evenement.encapsulation.json2022-11-23 13:35 98  
[   ]com.falconware.prestissimo.json2022-11-23 12:56 98  
[   ]com.germainz.identiconizer.json2022-11-23 10:33 98  
[   ]com.ghostsq.commander.samba.json2022-11-23 10:20 98  
[   ]com.github.grimpy.botifier.json2022-11-23 07:22 98  
[   ]com.github.mofosyne.tagdrop.json2022-11-23 07:05 98  
[   ]com.github.sryze.wirebug.json2022-11-23 05:50 98  
[   ]com.github.wakhub.tinyclock.json2022-11-23 05:43 98  
[   ]com.github.webierta.carfoin.json2022-11-23 05:42 98  
[   ]com.igormaznitsa.piratedice.json2022-11-23 02:15 98  
[   ]com.innodroid.mongobrowser.json2022-11-23 01:35 98  
[   ]com.kidozh.discuzhub.fdroid.json2022-11-22 22:07 98  
[   ]com.majeur.applicationsinfo.json2022-11-22 17:17 98  
[   ]com.mattgmg.miracastwidget.json2022-11-22 16:30 98  
[   ]com.mod.android.widget.fbcw.json2022-11-22 15:19 98  
[   ]com.nolanlawson.apptracker.json2022-11-22 11:37 98  
[   ]com.nolanlawson.chordreader.json2022-11-22 11:36 98  
[   ]com.notriddle.null_launcer.json2022-11-22 10:33 98  
[   ]com.rastating.droidbeard.json2022-11-22 04:45 98  
[   ]com.saverio.wordoftheday_en.json2022-11-22 02:29 98  
[   ]com.suyashsrijan.forcedoze.json2022-11-21 23:18 98  
[   ]com.trianguloy.isUserAMonkey.json2022-11-21 20:49 98  
[   ]com.ultrafunk.network_info.json2022-11-21 19:13 98  
[   ]com.wesaphzt.privatelocation.json2022-11-21 16:19 98  
[   ]daniel_32.flexiblewallpaper.json2022-11-21 08:10 98  
[   ]de.b0nk.fp1_epo_autoupdate.json2022-11-21 08:03 98  
[   ]de.boesling.hydromemo.json2022-11-21 05:31 98  
[   ]de.hu_berlin.eduroam.json2022-11-21 01:49 98  
[   ]de.idiomreplacex.browser_app.json2022-11-21 01:49 98  
[   ]de.j4velin.systemappmover.json2022-11-21 01:46 98  
[   ]de.lukaspieper.gcam.services.json2022-11-20 23:09 98  
[   ]de.phoenixstudios.pc_dimmer.json2022-11-20 21:22 98  
[   ]de.shandschuh.slightbackup.json2022-11-20 19:49 98  
[   ]edu.cmu.cs.speech.tts.flite.json2022-02-05 22:02 98  
[   ]eu.veldsoft.colors.overflow.json2022-11-20 08:14 98  
[   ]eu.veldsoft.tuty.fruty.slot.json2022-11-20 07:57 98  
[   ]eu.wikijourney.wikijourney.json2022-11-20 07:53 98  
[   ]fi.harism.wallpaper.yinyang.json2022-11-20 07:27 98  
[   ]fr.ybo.transportsbordeaux.json2022-11-20 02:20 98  
[   ]free.rm.skytube.legacy.oss.json2022-11-20 06:45 98  
[   ]im.r_c.android.clearweather.json2022-11-20 00:33 98  
[   ]info.guardianproject.cacert.json2022-11-19 22:32 98  
[   ]info.guardianproject.gilga.json2022-11-19 22:29 98  
[   ]io.github.sanbeg.flashlight.json2022-11-19 17:39 98  
[   ]io.githubfede0d.planetrider.json2022-11-19 20:07 98  
[   ]me.konyaco.collinsdictionary.json2022-11-18 20:57 98  
[   ]name.bagi.levente.pedometer.json2022-11-18 18:09 98  
[   ]net.bitconomy.ckpoolwatcher.json2022-11-18 12:34 98  
[   ]net.khertan.forrunners.json2022-11-18 11:11 98  
[   ]net.schueller.instarepost.json2022-11-18 01:01 98  
[   ]nl.patrickkostjens.kandroid.json2022-11-17 21:33 98  
[   ]org.androidpn.client.json2022-11-17 18:57 98  
[   ]org.developfreedom.logmein.json2022-11-17 14:25 98  
[   ]org.dynamicsoft.caloriescope.json2022-11-17 12:59 98  
[   ]org.eukalyptus.liquidrechner.json2022-11-17 12:28 98  
[   ]org.flyve.mdm.agent.mqtt.json2022-11-17 11:47 98  
[   ]org.gege.caldavsyncadapter.json2022-11-17 10:19 98  
[   ]org.jfedor.nxtremotecontrol.json2022-11-17 06:55 98  
[   ]org.openintents.notepad.json2022-11-16 18:22 98  
[   ]org.schabi.sharewithnewpipe.json2022-11-16 07:29 98  
[   ]org.zephyrsoft.checknetwork.json2022-11-25 20:16 98  
[   ]pt.joaomneto.titancompanion.json2022-11-25 16:54 98  
[   ]sk.madzik.android.logcatudp.json2022-11-25 13:17 98  
[   ]uk.ac.ed.inf.mandelbrotmaps.json2022-11-25 11:01 98  
[   ]uscartools.USTravelConverter.json2022-11-25 09:48 98  
[   ]zen.meditation.android.json2022-11-25 08:47 98  
[   ]at.manuelbichler.octalsuntime.json2022-11-24 13:53 99  
[   ]aws.apps.usbDeviceEnumerator.json2022-11-24 13:31 99  
[   ]be.brunoparmentier.dnssetter.json2022-11-24 13:28 99  
[   ]be.ugent.zeus.hydra.open.json2022-11-24 13:17 99  
[   ]ca.farrelltonsolar.classic.json2022-11-24 13:04 99  
[   ]ch.abertschi.waterme.water_me.json2022-11-24 12:25 99  
[   ]ch.jiikuy.velocitycalculator.json2022-11-24 11:45 99  
[   ]click.dummer.funphonepuppet.json2022-11-24 10:34 99  
[   ]com.Bisha.TI89EmuDonation.json2022-11-24 01:11 99  
[   ]com.aidinhut.simpletextcrypt.json2022-11-24 09:26 99  
[   ]com.albertobonacina.wassword.json2022-11-24 09:21 99  
[   ]com.benarmstead.simplecooking.json2022-11-24 02:13 99  
[   ]com.catalin.css_px_converter.json2022-11-23 22:22 99  
[   ]com.cliffracertech.soundaura.json2022-11-23 20:35 99  
[   ]com.danielme.muspyforandroid.json2022-11-23 18:15 99  
[   ]com.digitalfishfun.openshift.json2022-11-23 17:15 99  
[   ]com.example.harisont.librery.json2022-11-23 13:23 99  
[   ]com.frozendevs.periodictable.json2022-11-23 11:37 99  
[   ]com.garyodernichts.downgrader.json2022-11-23 11:15 99  
[   ]com.github.funkyg.funkytunes.json2022-11-23 07:34 99  
[   ]com.github.pires.obd.reader.json2022-11-23 06:49 99  
[   ]com.github.shadowsocks.json2022-11-23 06:08 99  
[   ]com.gmail.cn.leetao94.rssaid.json2022-11-23 05:22 99  
[   ]com.gmail.mugcuposup.android.json2022-11-23 05:16 99  
[   ]com.gonnaggstudio.oh_tai_gi.json2022-11-23 05:11 99  
[   ]com.infonuascape.osrshelper.json2022-11-23 01:35 99  
[   ]com.kanedias.archforums.json2022-11-22 22:48 99  
[   ]com.lubenard.oring_reminder.json2022-11-22 18:21 99  
[   ]com.mendhak.conscryptprovider.json2022-11-22 16:08 99  
[   ]com.saladdressing.veterondo.json2022-11-22 03:47 99  
[   ]com.scar45.aokp.co.webviewer.json2022-11-22 02:29 99  
[   ]com.theworld.help.cbtandroid.json2022-11-21 22:20 99  
[   ]com.twoeightnine.root.xvii.json2022-11-21 19:45 99  
[   ]com.urbandroid.dontkillmyapp.json2022-11-21 18:07 99  
[   ]com.xabber.android.classic.json2022-11-21 15:45 99  
[   ]de.bashtian.dashclocksunrise.json2022-11-21 07:47 99  
[   ]de.telefongarten.brainjogging.json2022-11-20 17:32 99  
[   ]de.uwepost.android.deltacam.json2022-11-20 15:13 99  
[   ]de.yazo_games.mensaguthaben.json2022-11-20 12:58 99  
[   ]dev.obfusk.sokobang.json2022-11-20 14:40 99  
[   ]eu.veldsoft.vitosha.blackjack.json2022-11-20 07:54 99  
[   ]fi.harism.wallpaper.flowers.json2022-11-20 07:28 99  
[   ]info.zwanenburg.caffeinetile.json2022-11-19 21:05 99  
[   ]io.github.danxi_dev.dan_xi.json2022-11-19 20:28 99  
[   ]io.github.easyintent.quickref.json2022-11-19 20:08 99  
[   ]io.github.yawnoc.strokeinput.json2022-11-19 16:27 99  
[   ]it.andreascarpino.hostisdown.json2022-11-19 13:00 99  
[   ]it.lucci.cm.greyscaletheme.json2022-11-19 11:39 99  
[   ]it.rignanese.leo.slimtwitter.json2022-11-19 09:56 99  
[   ]jp.gr.java_conf.hatalab.mnv.json2022-11-19 09:01 99  
[   ]me.alexghr.android.bulkshare.json2022-11-18 23:22 99  
[   ]nerd.tuxmobil.fahrplan.camp.json2022-11-18 17:29 99  
[   ]net.mafro.android.wakeonlan.json2022-11-18 10:49 99  
[   ]net.sf.andbatdog.batterydog.json2022-11-18 00:41 99  
[   ]net.sf.andhsli.hotspotlogin.json2022-11-18 00:40 99  
[   ]news.androidtv.launchonboot.json2022-11-17 21:56 99  
[   ]org.androidappdev.wifiwidget.json2022-11-17 19:06 99  
[   ]org.cprados.wificellmanager.json2022-11-17 14:49 99  
[   ]org.glpi.inventory.agent.json2022-11-17 10:07 99  
[   ]org.handmadeideas.chordreader.json2022-11-17 08:33 99  
[   ]org.kde.necessitas.ministro.json2022-11-17 06:19 99  
[   ]org.mupen64plusae.v3.alpha.json2022-11-16 21:30 99  
[   ]org.owntracks.android.json2022-11-16 16:18 99  
[   ]org.purple.smokestack.json2022-11-16 13:52 99  
[   ]org.schabi.openhitboxstreams.json2022-11-16 07:31 99  
[   ]org.strawberryforum.pollywog.json2022-11-26 04:32 99  
[   ]org.surrel.messengerbypasser.json2022-11-26 03:47 99  
[   ]org.wheelmap.android.online.json2022-11-25 21:55 99  
[   ]pc.javier.actualizadoropendns.json2022-11-25 19:45 99  
[   ]pl.narfsoftware.thermometer.json2022-11-25 17:43 99  
[   ]pro.rudloff.search_to_browser.json2022-11-25 17:19 99  
[   ]ru.sash0k.bluetooth_terminal.json2022-11-25 15:00 99  
[   ]se.danielj.geometridestroyer.json2022-11-25 14:37 99  
[   ]se.erikofsweden.findmyphone.json2022-11-25 14:33 99  
[   ]tw.com.daxia.virtualsoftkeys.json2022-11-25 11:07 99  
[   ]us.achromaticmetaphor.agram.json2022-11-25 09:50 99  
[   ]com.alaskalinuxuser.hourglass.json2022-11-24 09:26 100  
[   ]com.alaskalinuxuser.justnotes.json2022-11-24 09:23 100  
[   ]com.alienpants.leafpicrevived.json2022-11-24 09:03 100  
[   ]com.brosmike.airpushdetector.json2022-11-23 22:46 100  
[   ]com.correctsyntax.biblenotify.json2022-11-23 19:42 100  
[   ]com.einmalfel.podlisten.json2022-11-23 15:29 100  
[   ]com.eleybourn.bookcatalogue.json2022-11-23 15:06 100  
[   ]com.frozendevs.cache.cleaner.json2022-11-23 11:38 100  
[   ]com.github.kiliakin.yalpstore.json2022-11-23 07:16 100  
[   ]com.github.yeriomin.workoutlog.json2022-11-23 05:30 100  
[   ]com.github.ympavlov.minidoro.json2022-11-23 05:28 100  
[   ]com.gunshippenguin.openflood.json2022-11-23 04:01 100  
[   ]com.harasoft.relaunch.json2022-11-23 03:53 100  
[   ]com.hectorone.multismssender.json2022-11-23 02:43 100  
[   ]com.htruong.inputmethod.latin.json2022-11-23 02:34 100  
[   ]com.iboalali.sysnotifsnooze.json2022-11-23 02:22 100  
[   ]com.jarsilio.android.pocketup.json2022-11-23 00:50 100  
[   ]com.kanedias.vanilla.metadata.json2022-11-22 22:24 100  
[   ]com.khuttun.notificationnotes.json2022-11-22 22:08 100  
[   ]com.leafdigital.kanji.android.json2022-11-22 20:38 100  
[   ]com.michaeltroger.gruenerpass.json2022-11-22 15:49 100  
[   ]com.mustafaali.sensorssandbox.json2022-11-22 14:10 100  
[   ]com.mystro256.autooffbluetooth.json2022-11-22 14:06 100  
[   ]com.namsor.api.samples.gendre.json2022-11-22 14:05 100  
[   ]com.nesswit.galbijjimsearcher.json2022-11-22 13:48 100  
[   ]com.npes87184.s2tdroid.donate.json2022-11-22 10:32 100  
[   ]com.orpheusdroid.sqliteviewer.json2022-11-22 08:34 100  
[   ]com.rascarlo.power.button.tile.json2022-11-22 04:45 100  
[   ]com.roguetemple.hyperroid.json2022-11-22 04:05 100  
[   ]com.saiga.find.messagefinder.json2022-11-22 03:47 100  
[   ]com.samsandberg.mtafarebuster.json2022-11-22 02:52 100  
[   ]de.ktran.anno1404warenrechner.json2022-11-20 23:30 100  
[   ]de.sorunome.unifiednlp.trains.json2022-11-20 19:37 100  
[   ]dev.linwood.butterfly.nightly.json2022-11-20 14:53 100  
[   ]edu.harvard.android.mmskeeper.json2022-11-20 11:54 100  
[   ]eu.lighthouselabs.obd.reader.json2022-11-20 10:07 100  
[   ]eu.veldsoft.vitosha.poker.odds.json2022-11-20 07:53 100  
[   ]info.staticfree.SuperGenPass.json2022-11-19 21:28 100  
[   ]io.github.muntashirakon.unapkm.json2022-11-19 17:41 100  
[   ]io.gitlab.danielrparks.vibrato.json2022-11-19 16:27 100  
[   ]io.nandandesai.privacybreacher.json2022-11-19 15:38 100  
[   ]jupiter.broadcasting.live.tv.json2022-11-19 08:44 100  
[   ]krasilnikov.alexey.cryptopass.json2022-11-19 08:29 100  
[   ]mbmb5.lumixextendedcontrolapp.json2022-11-18 23:31 100  
[   ]net.logomancy.dashquotes.civ5.json2022-11-18 10:54 100  
[   ]net.usikkert.kouchat.android.json2022-11-17 22:40 100  
[   ]org.androidsoft.games.slowit.json2022-11-17 18:52 100  
[   ]org.covolunablu.marswallpaper.json2022-11-17 14:50 100  
[   ]org.cyanogenmod.great.freedom.json2022-11-17 14:47 100  
[   ]org.hollowbamboo.chordreader2.json2022-11-17 08:07 100  
[   ]org.kaziprst.android.ndfilter.json2022-11-17 06:48 100  
[   ]org.proninyaroslav.libretrack.json2022-11-16 14:20 100  
[   ]org.secuso.privacyfriendlydame.json2022-11-16 07:18 100  
[   ]org.secuso.privacyfriendlypin.json2022-11-16 06:38 100  
[   ]org.toulibre.capitoledulibre.json2022-11-26 00:19 100  
[   ]se.bitcraze.crazyfliecontrol2.json2022-11-25 14:37 100  
[   ]ca.littlesvr.everyonestimetable.json2022-11-24 12:56 101  
[   ]com.allansimon.verbisteandroid.json2022-11-24 09:03 101  
[   ]com.beckhamd.nasaimageryfetcher.json2021-04-02 08:54 101  
[   ]com.briankhuu.nfcmessageboard.json2022-11-23 22:58 101  
[   ]com.bytesforge.linkasanote.json2022-11-23 22:28 101  
[   ]com.crazyhitty.chdev.ks.munch.json2022-11-23 19:33 101  
[   ]com.emacberry.uuid0xfd6fscan.json2022-11-23 14:37 101  
[   ]com.emmanuelmess.simplecleanup.json2022-11-23 14:36 101  
[   ]com.fredhappyface.brainf.json2022-11-23 11:53 101  
[   ]com.fredhappyface.fhcode.json2022-11-23 11:53 101  
[   ]com.github.andreyasadchy.xtra.json2022-11-23 09:24 101  
[   ]com.github.darthjoey91.hangman.json2022-11-23 08:07 101  
[   ]com.gitlab.giwiniswut.rwremount.json2022-11-23 05:25 101  
[   ]com.hayaisoftware.launcher.json2022-11-23 03:10 101  
[   ]com.littlebytesofpi.pylauncher.json2022-11-22 19:02 101  
[   ]com.maxfierke.sandwichroulette.json2022-11-22 16:29 101  
[   ]com.miloshpetrov.sol2.android.json2022-11-22 15:45 101  
[   ]com.nolanlawson.jnameconverter.json2022-11-22 11:34 101  
[   ]com.nomadlabs.labcoat.deeplinks.json2022-11-22 11:33 101  
[   ]com.nononsenseapps.notepad.json2022-11-22 10:53 101  
[   ]com.primavera.arduino.listener.json2022-11-22 05:46 101  
[   ]com.procrastimax.birthdaybuddy.json2022-11-22 05:46 101  
[   ]com.ridgelineapps.resdicegame.json2022-11-22 04:17 101  
[   ]com.simplemobiletools.keyboard.json2022-11-22 00:07 101  
[   ]com.stealthcotper.networktools.json2022-11-21 23:34 101  
[   ]com.tistory.deque.previewmaker.json2022-11-21 22:13 101  
[   ]com.xatik.app.droiddraw.client.json2022-11-21 15:26 101  
[   ]com.zoffcc.applications.aagtl.json2022-11-21 14:56 101  
[   ]com.zoffcc.fahrplan.toxcon.json2022-11-21 13:50 101  
[   ]community.fairphone.checkup.json2022-11-22 14:17 101  
[   ]de.beatbrot.screenshotassistant.json2022-11-21 07:02 101  
[   ]de.binary_kitchen.doorlock_app.json2022-11-21 06:58 101  
[   ]de.perflyst.batterycalibration.json2022-11-20 21:26 101  
[   ]de.taz.android.app.free.json2022-11-20 17:45 101  
[   ]de.wikilab.android.friendica01.json2022-11-20 13:39 101  
[   ]fr.simon.marquis.secretcodes.json2022-11-20 02:54 101  
[   ]github.vatsal.easyweatherdemo.json2022-11-20 02:06 101  
[   ]io.github.powerinside.syncplay.json2022-11-19 17:39 101  
[   ]io.github.subhamtyagi.nightmode.json2022-11-19 17:31 101  
[   ]it.mobimentum.dualsimwidget.json2022-11-19 11:33 101  
[   ]me.danielbarnett.addresstogps.json2022-11-18 21:18 101  
[   ]negativedensity.techahashi.json2022-11-18 17:38 101  
[   ]net.sourceforge.wifiremoteplay.json2022-11-17 23:09 101  
[   ]org.developfreedom.ccdroid.app.json2022-11-17 14:27 101  
[   ]org.dyndns.sven_ola.debian_kit.json2022-11-17 12:59 101  
[   ]org.github.henryquan.animeone.json2022-11-17 10:12 101  
[   ]org.noise_planet.noisecapture.json2022-11-16 21:03 101  
[   ]org.openintents.flashlight.json2022-11-16 18:22 101  
[   ]org.pixmob.freemobile.netstat.json2022-11-16 15:27 101  
[   ]org.secuso.privacyfriendly2048.json2022-11-16 07:23 101  
[   ]org.tigase.messenger.phone.pro.json2022-11-26 01:49 101  
[   ]org.tmurakam.presentationtimer.json2022-11-26 01:32 101  
[   ]pl.net.szafraniec.NFCTagmaker.json2022-11-25 17:37 101  
[   ]tomer.com.alwaysonamoledplugin.json2022-11-25 11:36 101  
[   ]uk.co.keepawayfromfire.screens.json2022-11-25 09:59 101  
[   ]uk.co.yahoo.p1rpp.secondsclock.json2022-11-25 09:58 101  
[   ]app.reading.stoic.stoicreading2.json2022-11-24 15:04 102  
[   ]be.brunoparmentier.wifikeyshare.json2022-11-24 13:26 102  
[   ]ca.mudar.fairphone.peaceofmind.json2022-11-24 12:55 102  
[   ]com.adstrosoftware.launchappops.json2022-11-24 09:31 102  
[   ]com.casimirlab.simpleDeadlines.json2022-11-23 22:24 102  
[   ]com.commonsware.android.arXiv.json2022-11-23 19:48 102  
[   ]com.corphish.nightlight.generic.json2022-11-23 19:42 102  
[   ]com.dje.openwifinetworkremover.json2022-11-23 17:01 102  
[   ]com.dozingcatsoftware.asciicam.json2022-11-23 16:19 102  
[   ]com.eneko.hexcolortimewallpaper.json2022-11-23 14:35 102  
[   ]com.example.flutter_http_server.json2022-11-23 13:27 102  
[   ]com.github.palmcalc2019.palmcalc.json2022-11-23 06:49 102  
[   ]com.github.samotari.paynoway.json2022-11-23 06:08 102  
[   ]com.github.shadowsocks.tv.json2022-11-23 05:56 102  
[   ]com.github.whyrising.flashyalarm.json2022-11-23 05:42 102  
[   ]com.google.android.diskusage.json2022-11-23 05:07 102  
[   ]com.google.android.location.json2022-11-23 05:05 102  
[   ]com.jakewharton.sdksearch.json2022-11-23 00:56 102  
[   ]com.jesperh.showyoutubedislikes.json2022-11-23 00:13 102  
[   ]com.kyakujin.android.tagnotepad.json2022-11-22 21:27 102  
[   ]com.paranoid.ParanoidWallpapers.json2022-11-22 08:01 102  
[   ]com.pixiv.muzei.pixivsource.json2022-11-22 06:51 102  
[   ]com.simplemobiletools.contacts.json2022-11-22 00:44 102  
[   ]com.starapps.tools.tnefextractor.json2022-11-21 23:34 102  
[   ]com.thehoick.evergreenwishlist.json2022-11-21 22:27 102  
[   ]com.totsp.crossword.shortyz.json2022-11-21 21:02 102  
[   ]com.voidcode.diasporawebclient.json2022-11-21 17:09 102  
[   ]com.willchan.simple_random_stock.json2022-11-21 16:19 102  
[   ]com.willianveiga.countdowntimer.json2022-11-21 16:18 102  
[   ]com.xlythe.calculator.material.json2022-11-21 15:19 102  
[   ]cz.mendelu.xmarik.train_manager.json2022-11-21 08:12 102  
[   ]de.seemoo.at_tracking_detection.json2022-11-20 19:53 102  
[   ]de.ub0r.android.smsdroid.json2022-11-20 15:16 102  
[   ]dev.corruptedark.diditakemymeds.json2022-11-20 15:10 102  
[   ]dev.dworks.apps.anexplorer.pro.json2022-02-06 00:16 102  
[   ]dev.obfusk.jiten_webview.json2022-11-20 14:40 102  
[   ]eu.flatworld.android.slider.json2022-11-20 10:49 102  
[   ]eu.siacs.conversations.legacy.json2022-11-20 08:30 102  
[   ]fr.nicopico.dashclock.birthday.json2022-11-20 03:49 102  
[   ]it.danieleverducci.nextcloudmaps.json2022-11-19 12:59 102  
[   ]mazechazer.android.wottankquiz.json2022-11-19 06:55 102  
[   ]me.jakelane.wrapperforfacebook.json2022-11-18 20:58 102  
[   ]net.bitplane.android.microphone.json2022-11-18 12:33 102  
[   ]net.christianbeier.droidvnc_ng.json2022-11-18 12:29 102  
[   ]net.loeuillet.wifi_eap_sim_conf.json2022-11-18 10:54 102  
[   ]nodom.darkfm.inventoryguimobile.json2022-11-17 21:19 102  
[   ]nu.firetech.android.pactrack.json2022-11-17 21:17 102  
[   ]nu.firetech.android.wifiwarning.json2022-11-17 21:14 102  
[   ]org.androidsoft.app.permission.json2022-11-17 18:55 102  
[   ]org.chickenhook.startflagexploit.json2022-11-17 15:57 102  
[   ]org.cmotc.tools.rotationlockpp.json2022-11-17 15:49 102  
[   ]org.lf_net.pgpunlocker.json2022-11-17 05:25 102  
[   ]org.miamplayer.autoairplanemode.json2022-11-17 01:17 102  
[   ]org.navitproject.navit.json2022-11-16 21:26 102  
[   ]org.schabi.nxbookmarks.owncloud.json2022-11-16 07:31 102  
[   ]org.secuso.privacyfriendlybackup.json2022-11-16 07:20 102  
[   ]org.secuso.privacyfriendlyruler.json2022-11-16 06:34 102  
[   ]org.wikimedia.commons.wikimedia.json2022-11-25 21:44 102  
[   ]pcmagas.vodafone_fu_h300s.json2022-11-25 19:42 102  
[   ]sterrenburg.github.flutterhole.json2022-11-25 13:09 102  
[   ]tk.radioactivemineral.metronome.json2022-11-25 11:51 102  
[   ]uk.co.busydoingnothing.catverbs.json2022-11-25 11:00 102  
[   ]us.lindanrandy.cidrcalculator.json2022-11-25 09:47 102  
[   ]amirz.rootless.nexuslauncher.json2022-11-24 15:33 103  
[   ]ca.pr0ps.xposed.entrustunblocker.json2022-11-24 12:53 103  
[   ]ch.rrelmy.android.batterymanager.json2022-11-24 10:43 103  
[   ]com.banasiak.coinflipext.example.json2022-11-24 04:11 103  
[   ]com.brentpanther.ethereumwidget.json2022-11-23 23:01 103  
[   ]com.brentpanther.litecoinwidget.json2022-11-23 23:01 103  
[   ]com.futurice.android.reservator.json2022-11-23 11:20 103  
[   ]com.github.axet.darknessimmunity.json2022-11-23 09:01 103  
[   ]com.github.webierta.call_counter.json2022-11-23 05:43 103  
[   ]com.github.yeriomin.smsscheduler.json2022-11-23 05:30 103  
[   ]com.gtp.showapicturetoyourfriend.json2022-11-23 04:13 103  
[   ]com.ihunda.android.binauralbeat.json2022-11-23 02:14 103  
[   ]com.jefftharris.passwdsafe.json2022-11-23 00:33 103  
[   ]com.kibab.android.EncPassChanger.json2022-11-22 22:07 103  
[   ]com.lindevhard.android.raspfinder.json2022-11-22 19:04 103  
[   ]com.linuxcounter.lico_update_003.json2022-11-22 19:04 103  
[   ]com.lucasdnd.unixtimeclockwidget.json2022-11-22 18:03 103  
[   ]com.mirfatif.permissionmanagerx.json2022-11-22 15:41 103  
[   ]com.outerworldapps.wairtonow.json2022-11-22 08:33 103  
[   ]com.releasestandard.scriptmanager.json2022-11-22 04:18 103  
[   ]com.threedlite.userhash.location.json2022-11-21 22:17 103  
[   ]com.vanderbie.heart_rate_monitor.json2022-11-21 17:59 103  
[   ]com.wbrawner.simplemarkdown.free.json2022-11-21 16:22 103  
[   ]com.willhauck.linconnectclient.json2022-11-21 16:19 103  
[   ]de.arnefeil.bewegungsmelder.json2022-11-21 08:06 103  
[   ]de.bloosberg.basti.childresuscalc.json2022-11-21 05:31 103  
[   ]de.cryptobitch.muelli.barcodegen.json2022-11-21 04:59 103  
[   ]de.igloffstein.maik.aRevelation.json2022-11-21 01:49 103  
[   ]de.naturalnet.zahnarztgeraeusche.json2022-11-20 21:41 103  
[   ]de.tu_darmstadt.seemoo.HardWhere.json2022-11-20 16:35 103  
[   ]de.viatorus.neo2externalkeyboard.json2022-11-20 15:09 103  
[   ]eth.matteljay.mastermindy.json2022-11-20 11:16 103  
[   ]gr.ratmole.android.Mach3Pendant.json2022-11-20 01:05 103  
[   ]in.ac.iitb.cse.cartsbusboarding.json2022-11-19 23:32 103  
[   ]io.github.tiagoshibata.gpsdclient.json2022-11-19 17:09 103  
[   ]io.gitlab.mudassir.youtubecacher.json2022-11-19 16:27 103  
[   ]io.krmanik.ankiimageocclusion.json2022-11-19 15:52 103  
[   ]italian.said.fran.theitaliansaid.json2022-11-19 13:02 103  
[   ]nerd.tuxmobil.fahrplan.congress.json2022-11-18 17:27 103  
[   ]net.bierbaumer.otp_authenticator.json2022-11-18 12:35 103  
[   ]net.everythingandroid.smspopup.json2022-11-18 12:10 103  
[   ]net.majorkernelpanic.spydroid.json2022-11-18 10:48 103  
[   ]net.nhiroki.bluesquarespeedometer.json2022-11-18 09:22 103  
[   ]net.ralphbroenink.muzei.unsplash.json2022-11-18 01:14 103  
[   ]network.loki.messenger.fdroid.json2022-11-17 22:14 103  
[   ]nodomain.vanous.blitztypekeyboard.json2022-11-17 21:19 103  
[   ]org.androidappdev.batterywidget.json2022-11-17 19:07 103  
[   ]org.androidsoft.games.memory.tux.json2022-11-17 18:53 103  
[   ]org.bitbucket.watashi564.combapp.json2022-11-17 16:29 103  
[   ]org.elijaxapps.androidxmrigminer.json2022-11-17 12:43 103  
[   ]org.hoi_polloi.android.ringcode.json2022-11-17 08:07 103  
[   ]org.microg.nlp.backend.apple.json2022-11-17 00:51 103  
[   ]org.penghuang.tools.rotationlock.json2022-11-16 15:49 103  
[   ]org.sufficientlysecure.viewer.json2022-11-26 03:52 103  
[   ]raffarti.simpleadvancedmetronome.json2022-11-25 16:50 103  
[   ]tech.waelk.radioactive.metronome.json2022-11-25 11:53 103  
[   ]ch.gassenarbeit.bern.your.rights.json2022-11-24 11:47 104  
[   ]com.brillenheini.deepscratch.free.json2022-11-23 22:58 104  
[   ]com.easwareapps.transparentwidget.json2022-11-23 15:43 104  
[   ]com.germainz.activityforcenewtask.json2022-11-23 10:33 104  
[   ]com.github.gianlucanitti.expreval.json2022-11-23 07:29 104  
[   ]com.github.jtjj222.sudburytransit.json2022-11-23 07:19 104  
[   ]com.gmail.afonsotrepa.pocketgopher.json2022-11-23 05:22 104  
[   ]com.gmail.jerickson314.sdscanner.json2022-11-23 05:17 104  
[   ]com.google.zxing.client.android.json2022-11-23 04:29 104  
[   ]com.jwetherell.heart_rate_monitor.json2022-11-22 22:51 104  
[   ]com.lgallardo.qbittorrentclient.json2022-11-22 20:25 104  
[   ]com.liveplayergames.finneypoker.json2022-11-22 18:54 104  
[   ]com.nathaniel.motus.umlclasseditor.json2022-11-22 13:55 104  
[   ]com.nightshadelabs.anotherbrowser.json2022-11-22 11:46 104  
[   ]com.pierreduchemin.punchlinebingo.json2022-11-22 07:17 104  
[   ]com.quaap.computationaldemonology.json2022-11-22 05:39 104  
[   ]com.teamdc.stephendiniz.autoaway.json2022-11-21 22:50 104  
[   ]com.vackosar.searchbasedlauncher.json2022-11-21 18:05 104  
[   ]com.weicheng.taipeiyoubikeoffline.json2022-11-21 16:22 104  
[   ]de.cryptobitch.muelli.vouchercalc.json2022-11-21 04:58 104  
[   ]de.example.fahrraddiebstahl_berlin.json2022-11-21 02:38 104  
[   ]de.markusfisch.android.screentime.json2022-11-20 23:07 104  
[   ]eu.schmidt.systems.opensyncedlists.json2022-11-20 08:56 104  
[   ]fr.ac_versailles.dane.xiaexpress.json2022-11-20 07:04 104  
[   ]io.github.droidapps.pdfreader.json2022-11-19 20:17 104  
[   ]io.github.martinschneider.juvavum.json2022-11-19 18:38 104  
[   ]io.mkg20001.arubanetworkslogin.json2022-11-19 15:48 104  
[   ]me.alexghr.bulkshare.android.app2.json2022-11-18 23:22 104  
[   ]me.guillaumin.android.osmtracker.json2022-11-18 21:07 104  
[   ]org.androidfromfrankfurt.archnews.json2022-11-17 19:06 104  
[   ]org.androidsoft.games.puzzle.kids.json2022-11-17 18:53 104  
[   ]org.congresointeractivo.elegilegi.json2022-11-17 15:45 104  
[   ]org.ocsinventoryng.android.agent.json2022-11-16 20:23 104  
[   ]org.polaric.cyanogenmodchangelog.json2022-11-16 15:26 104  
[   ]org.solovyev.android.calculator.json2022-11-16 05:04 104  
[   ]uk.co.jarofgreen.JustADamnCompass.json2022-11-25 09:59 104  
[   ]unisiegen.photographers.activity.json2022-11-25 09:52 104  
[   ]com.emmanuelmess.simpleaccounting.json2022-11-23 14:36 105  
[   ]com.episode6.android.appalarm.pro.json2022-11-23 14:25 105  
[   ]com.fredhappyface.ewesticker.json2022-11-23 11:53 105  
[   ]com.github.k1rakishou.chan.fdroid.json2022-11-23 07:16 105  
[   ]com.jmstudios.pointandhit.android.json2022-11-22 23:42 105  
[   ]com.monead.games.android.sequence.json2022-11-22 14:56 105  
[   ]com.shahul3d.indiasatelliteweather.json2022-11-22 01:08 105  
[   ]com.trianguloy.continuousDataUsage.json2022-11-21 20:49 105  
[   ]com.xvzan.simplemoneytracker.json2022-11-21 15:17 105  
[   ]de.enaikoon.android.keypadmapper3.json2022-11-21 03:08 105  
[   ]de.kromke.andreas.safmediascanner.json2022-11-20 23:54 105  
[   ]eu.veldsoft.svarka.odds.calculator.json2022-11-20 08:01 105  
[   ]fr.odrevet.kingdomino_score_count.json2022-11-20 03:15 105  
[   ]io.github.divverent.aaaaxy.json2022-11-19 20:20 105  
[   ]io.github.otobikb.inputmethod.latin.json2022-11-19 17:41 105  
[   ]io.github.powerinside.scrollsocket.json2022-11-19 17:41 105  
[   ]ml.vivekthazhathattil.chalachithram.json2022-11-18 19:06 105  
[   ]name.livitski.games.puzzle.android.json2022-11-18 17:43 105  
[   ]net.blumia.pineapple.lockscreen.oss.json2022-11-18 12:32 105  
[   ]net.yxejamir.misbotheringsms.json2022-11-17 21:56 105  
[   ]omegacentauri.mobi.simplestopwatch.json2022-11-17 21:04 105  
[   ]org.androidsoft.games.memory.kids.json2022-11-17 18:54 105  
[   ]org.debian.eugen.headingcalculator.json2022-11-17 14:41 105  
[   ]org.exarhteam.iitc_mobile.json2022-11-17 12:28 105  
[   ]org.inventati.massimol.liberovocab.json2022-11-17 07:53 105  
[   ]org.scotthamilton.trollslate.json2022-11-16 07:24 105  
[   ]tmendes.com.analyticalbalancedroid.json2022-11-25 11:49 105  
[   ]com.alaskalinuxuser.justcraigslist.json2022-11-24 09:25 106  
[   ]com.bottleworks.dailymoney.json2022-11-23 23:53 106  
[   ]com.dozingcatsoftware.vectorcamera.json2022-11-23 16:15 106  
[   ]com.fisheradelakin.interactivestory.json2022-11-23 12:32 106  
[   ]com.harleensahni.android.mbr.json2022-11-23 03:14 106  
[   ]com.menny.anysoftkeyboard.finnish.json2022-11-22 15:50 106  
[   ]com.radiostudent.radiostudentstream.json2022-11-22 05:15 106  
[   ]com.tkjelectronics.balanduino.json2022-11-21 22:12 106  
[   ]com.zoffcc.applications.avifview.json2022-11-21 14:53 106  
[   ]edu.stanford.rkpandey.covid19tracker.json2022-11-20 11:47 106  
[   ]fr.tvbarthel.apps.simplethermometer.json2022-11-20 02:52 106  
[   ]info.metadude.android.clt.schedule.json2022-11-19 22:22 106  
[   ]info.metadude.android.gpn.schedule.json2022-11-19 21:53 106  
[   ]io.github.trytonvanmeer.libretrivia.json2022-11-19 17:07 106  
[   ]io.librehealth.toolkit.cost_of_care.json2022-11-19 15:51 106  
[   ]nodomain.freeyourgadget.tpmsmonitor.json2022-11-17 21:20 106  
[   ]org.principate.matthew.dealing_sheet.json2022-11-16 15:01 106  
[   ]org.secuso.privacyfriendlypaindiary.json2022-11-16 06:49 106  
[   ]rs.pedjaapps.alogcatroot.app.json2022-11-25 16:38 106  
[   ]app.pott.kaffeepott.androidclient.json2021-03-13 10:04 107  
[   ]com.anysoftkeyboard.languagepack.SSH.json2022-11-24 07:11 107  
[   ]com.blogspot.developersu.ns_usbloader.json2022-11-24 00:15 107  
[   ]com.blogspot.tonyatkins.freespeech.json2022-11-24 00:08 107  
[   ]com.daviancorp.android.mh4udatabase.json2022-11-23 17:47 107  
[   ]com.github.andremiras.qrscan.json2022-11-23 10:11 107  
[   ]com.github.metacubex.clash.meta.json2022-11-23 07:13 107  
[   ]com.github.timnew.smartremotecontrol.json2022-11-23 05:50 107  
[   ]com.gitlab.kreikenbaum.suntime.fdroid.json2022-11-23 05:25 107  
[   ]com.hlidskialf.android.pomodoro.json2022-11-23 02:41 107  
[   ]com.juliansparber.captiveportallogin.json2022-11-22 23:07 107  
[   ]com.lgallardo.qbittorrentclientpro.json2022-11-22 20:12 107  
[   ]com.lucasdnd.decimaltimeclockwidget.json2022-11-22 18:09 107  
[   ]com.mathi_amorim.emmanuel.metrictime.json2022-11-22 16:33 107  
[   ]com.rascarlo.adaptive.brightness.tile.json2022-11-22 04:56 107  
[   ]com.rogerbassonsrenart.paddletennis.json2022-11-22 04:06 107  
[   ]com.trianguloy.numericriddlegenerator.json2022-11-21 20:49 107  
[   ]com.vonglasow.michael.voltagedrop.json2022-11-21 16:58 107  
[   ]cx.ring.json2022-11-21 08:38 107  
[   ]de.hoppfoundation.klassenzimmer.json2022-11-21 01:50 107  
[   ]de.k3b.android.contentproviderhelper.json2022-11-21 00:49 107  
[   ]de.xskat.json2022-02-05 22:50 107  
[   ]eu.siacs.conversations.voicerecorder.json2022-11-20 08:28 107  
[   ]info.metadude.android.hope.schedule.json2022-11-19 21:51 107  
[   ]it.diab.json2022-11-19 12:07 107  
[   ]it.sineo.android.noFrillsCPUClassic.json2022-11-19 09:56 107  
[   ]net.sourceforge.subsonic.androidapp.json2022-11-17 23:13 107  
[   ]nz.org.cacophony.birdmonitor.json2022-11-17 21:13 107  
[   ]org.sufficientlysecure.termbot.json2022-11-26 03:52 107  
[   ]tn.creativeteam.newyoutubelistingapp.json2022-11-25 11:49 107  
[   ]com.EthanHeming.NeuralNetworkSimulator.json2022-11-23 13:41 108  
[   ]com.adrienpoupa.attestationcoronavirus.json2022-11-24 09:31 108  
[   ]com.anysoftkeyboard.languagepack.pali.json2022-11-24 07:13 108  
[   ]com.catchingnow.tinyclipboardmanager.json2022-11-23 22:20 108  
[   ]com.developfreedom.wordpowermadeeasy.json2022-11-23 17:21 108  
[   ]com.example.root.analyticaltranslator.json2022-11-23 13:15 108  
[   ]com.freezingwind.animereleasenotifier.json2022-11-23 11:40 108  
[   ]com.github.characterdog.bmicalculator.json2022-11-23 08:13 108  
[   ]com.github.gschwind.fiddle_assistant.json2022-11-23 07:21 108  
[   ]com.github.nicolassmith.urlevaluator.json2022-11-23 06:55 108  
[   ]com.gulshansingh.hackerlivewallpaper.json2022-11-23 04:12 108  
[   ]com.intrications.android.sharebrowser.json2022-11-23 01:33 108  
[   ]com.kaneoriley.cyanogenport.launcher3.json2022-11-22 22:24 108  
[   ]com.myopicmobile.textwarrior.android.json2022-11-22 14:09 108  
[   ]com.simonslater.guitarfretboardtrainer.json2022-11-22 00:56 108  
[   ]de.bitsharesmunich.smartcoinswallet.json2022-11-21 06:57 108  
[   ]de.drhoffmannsoftware.xearth.json2022-11-21 03:19 108  
[   ]edu.cmu.cylab.starslinger.demo.json2022-11-20 12:11 108  
[   ]fr.herverenault.selfhostedgpstracker.json2022-11-20 04:20 108  
[   ]fr.jakse.raphael.simpleprotocolplayer.json2022-11-20 04:18 108  
[   ]fr.simon.marquis.preferencesmanager.json2022-11-20 02:57 108  
[   ]horse.amazin.my.stratum0.statuswidget.json2022-11-20 01:03 108  
[   ]io.github.domi04151309.podscompanion.json2022-11-19 20:18 108  
[   ]io.github.thachillera.cardsscorekeeper.json2022-11-19 17:09 108  
[   ]io.spaceapi.community.myhackerspace.json2022-11-19 15:11 108  
[   ]kaljurand_at_gmail_dot_com.diktofon.json2022-11-19 08:37 108  
[   ]org.bitbucket.tickytacky.mirrormirror.json2022-11-17 16:29 108  
[   ]org.developfreedom.wordpowermadeeasy.json2022-11-17 14:24 108  
[   ]org.fitchfamily.android.wifi_backend.json2022-11-17 11:55 108  
[   ]org.kiwix.kiwixcustomwikivoyageeurope.json2022-11-17 06:11 108  
[   ]org.liberty.android.fantastischmemo.json2022-11-17 05:25 108  
[   ]org.malinux.lectureFrancais.actLecture.json2022-11-17 02:17 108  
[   ]org.mattvchandler.progressbars.json2022-11-17 01:38 108  
[   ]org.projectvoodoo.screentestpatterns.json2022-11-16 14:31 108  
[   ]org.secuso.privacyfriendlycardgameone.json2022-11-16 07:19 108  
[   ]org.secuso.privacyfriendlyminesweeper.json2022-11-16 07:08 108  
[   ]org.secuso.privacyfriendlytapemeasure.json2022-11-16 06:28 108  
[   ]pro.rudloff.lineageos_updater_shortcut.json2022-11-25 17:21 108  
[   ]uk.co.danieljarvis.android.flashback.json2022-11-25 10:00 108  
[   ]com.alaskalinuxuser.shipcaptainandcrew.json2022-11-24 09:22 109  
[   ]com.eightsines.firestrike.opensource.json2022-11-23 15:29 109  
[   ]com.github.andremiras.etheroll.json2021-03-09 23:12 109  
[   ]com.github.niccokunzmann.hanumanchalisa.json2022-11-23 06:55 109  
[   ]com.github.samotari.cryptoterminal.json2022-11-23 06:09 109  
[   ]com.github.yeriomin.dumbphoneassistant.json2022-11-23 05:30 109  
[   ]com.jstappdev.identify_dog_breeds_pro.json2022-11-22 23:14 109  
[   ]de.mbutscher.wikiandpad.alphabeta.json2022-11-20 22:53 109  
[   ]fr.tvbarthel.apps.simpleweatherforcast.json2022-11-20 02:50 109  
[   ]liou.rayyuan.ebooksearchtaiwan.json2022-11-19 07:10 109  
[   ]name.starnberger.guenther.android.cbw.json2022-11-18 17:40 109  
[   ]org.secuso.privacyfriendlyintervaltimer.json2022-11-16 07:13 109  
[   ]tk.jordynsmediagroup.simpleirc.fdroid.json2022-11-25 11:51 109  
[   ]androdns.android.leetdreams.ch.androdns.json2022-11-24 15:32 110  
[   ]be.brunoparmentier.openbikesharing.app.json2022-11-24 13:27 110  
[   ]com.example.android.monthcalendarwidget.json2022-11-23 13:31 110  
[   ]com.github.characterdog.share_my_number.json2022-11-23 08:13 110  
[   ]com.google.android.apps.authenticator2.json2022-11-23 05:08 110  
[   ]com.prhlt.aemus.Read4SpeechExperiments.json2022-11-22 05:47 110  
[   ]com.rhiannonweb.android.migrainetracker.json2022-11-22 04:18 110  
[   ]com.vsmartcard.remotesmartcardreader.app.json2022-11-21 16:56 110  
[   ]com.wa2c.android.cifsdocumentsprovider.json2022-11-21 16:53 110  
[   ]de.jonasbernard.tudarmstadtmoodlewrapper.json2022-11-21 01:04 110  
[   ]de.nodomain.tobihille.seniorlauncher.json2022-11-20 21:39 110  
[   ]de.salomax.muzei.thevergewallpapers.json2022-11-20 20:02 110  
[   ]net.androcom.dho.speakerproximity.json2022-11-18 17:24 110  
[   ]org.pareudepararme.pareu_de_pararme_map.json2022-11-16 15:53 110  
[   ]souch.smp.json2022-11-25 13:15 110  
[   ]com.anysoftkeyboard.languagepack.tatar.json2022-11-24 07:10 111  
[   ]com.github.notizklotz.derbunddownloader.json2022-11-23 06:54 111  
[   ]com.jerboa.json2022-11-23 00:16 111  
[   ]com.tiwa.pl.json2022-11-21 22:13 111  
[   ]net.georgewhiteside.android.abstractart.json2022-11-18 11:56 111  
[   ]net.opendasharchive.openarchive.release.json2022-11-18 09:14 111  
[   ]nl.mpcjanssen.simpletask.nextcloud.json2022-11-17 21:34 111  
[   ]org.ametro.json2022-11-17 19:25 111  
[   ]org.secuso.privacyfriendlyboardgameclock.json2022-11-16 07:20 111  
[   ]org.secuso.privacyfriendlycircuittraining.json2022-11-16 07:18 111  
[   ]telegra.ph.json2022-11-25 11:53 111  
[   ]ca.cmetcalfe.xposed.flatconnectivityicons.json2022-11-24 13:04 112  
[   ]ch.admin.bag.covidcertificate.wallet.json2022-11-24 12:25 112  
[   ]com.androidfromfrankfurt.workingtimealert.json2022-11-24 08:49 112  
[   ]com.anysoftkeyboard.languagepack.french.json2022-11-24 07:16 112  
[   ]com.aptasystems.dicewarepasswordgenerator.json2022-11-24 06:57 112  
[   ]com.github.andremiras.zbarcamdemo.json2022-11-23 09:47 112  
[   ]com.seawolfsanctuary.keepingtracks.json2022-11-22 02:09 112  
[   ]com.theksmith.android.car_bus_interface.json2022-11-21 22:25 112  
[   ]io.github.webbluetoothcg.bletestperipheral.json2022-11-19 17:06 112  
[   ]me.zhanghai.android.textselectionwebsearch.json2022-11-18 19:55 112  
[   ]name.seguri.android.getforegroundactivity.json2022-11-18 17:41 112  
[   ]org.geometerplus.fbreader.plugin.tts.json2022-11-17 10:16 112  
[   ]org.ghostsinthelab.apps.guilelessbopomofo.json2022-11-17 10:12 112  
[   ]org.sufficientlysecure.standalonecalendar.json2022-11-26 03:59 112  
[   ]starcom.snd.json2022-11-25 13:10 112  
[   ]ademar.bitac.json2022-11-24 15:38 113  
[   ]ca.momi.lift.json2022-11-24 12:55 113  
[   ]com.anysoftkeyboard.languagepack.catalan.json2022-11-24 07:17 113  
[   ]com.anysoftkeyboard.languagepack.malayalam.json2022-11-24 07:14 113  
[   ]com.anysoftkeyboard.languagepack.slovene.json2022-11-24 07:11 113  
[   ]com.anysoftkeyboard.languagepack.swedish.json2022-11-24 07:10 113  
[   ]com.shatteredpixel.shatteredpixeldungeon.json2022-11-22 01:05 113  
[   ]de.antonfluegge.android.yubnubwidgetadfree.json2022-11-21 08:07 113  
[   ]de.kugihan.dictionaryformids.hmi_android.json2022-11-20 23:28 113  
[   ]de.ub0r.android.websms.connector.gmx.json2022-11-20 15:16 113  
[   ]im.fdx.v2ex.json2022-11-20 00:38 113  
[   ]org.geometerplus.zlibrary.ui.android.json2022-11-17 10:15 113  
[   ]org.projectvoodoo.simplecarrieriqdetector.json2022-11-16 14:31 113  
[   ]org.secuso.privacyfriendlypausinghealthily.json2022-11-16 06:40 113  
[   ]org.spechide.btappnder.whatsapptransmitter.json2022-11-26 04:39 113  
[   ]org.unifiedpush.distributor.noprovider2push.json2022-11-25 23:11 113  
[   ]org.woheller69.audio_analyzer_for_android.json2022-11-25 21:28 113  
[   ]be.casperverswijvelt.unifiedinternetqs.json2022-11-24 13:25 114  
[   ]ch.admin.bag.covidcertificate.verifier.json2022-11-24 12:25 114  
[   ]com.anysoftkeyboard.languagepack.icelandic.json2022-11-24 07:15 114  
[   ]com.example.tobiastrumm.freifunkautoconnect.json2022-11-23 13:12 114  
[   ]com.ideasfrombrain.search_based_launcher_v2.json2022-11-23 02:17 114  
[   ]com.vecturagames.android.app.passwordmaster.json2022-11-21 17:48 114  
[   ]de.neuwirthinformatik.alexander.archerystats.json2022-11-20 21:39 114  
[   ]info.metadude.android.libreoffice.schedule.json2022-11-19 21:49 114  
[   ]it.collideorscopeapps.codename_hippopotamos.json2022-11-19 12:59 114  
[   ]org.tuxpaint.json2022-11-25 23:38 114  
[   ]com.anysoftkeyboard.languagepack.afrikaans.json2022-11-24 07:18 115  
[   ]com.anysoftkeyboard.languagepack.dutch_oss.json2022-11-24 07:16 115  
[   ]com.anysoftkeyboard.languagepack.ukrainian.json2022-11-24 07:10 115  
[   ]com.unwrappedapps.android.wallpaper.creative.json2022-11-21 18:30 115  
[   ]de.Cherubin7th.blackscreenpresentationremote.json2022-11-21 05:21 115  
[   ]org.jsl.wfwt.json2022-11-17 06:49 115  
[   ]zame.GloomyDungeons.opensource.game.json2022-11-25 08:48 115  
[   ]com.anysoftkeyboard.languagepack.indonesian.json2022-11-24 07:14 116  
[   ]com.anysoftkeyboard.languagepack.macedonian.json2022-11-24 07:14 116  
[   ]com.anysoftkeyboard.languagepack.ossturkish.json2022-11-24 07:13 116  
[   ]com.developerfromjokela.motioneyeclient.json2022-11-23 17:21 116  
[   ]com.github.olga_yakovleva.rhvoice.android.json2022-11-23 06:52 116  
[   ]com.martinborjesson.o2xtouchlednotifications.json2022-11-22 16:46 116  
[   ]info.metadude.android.bitsundbaeume.schedule.json2022-11-19 22:24 116  
[   ]org.osmdroid.json2022-11-16 16:21 116  
[   ]chromiumupdater.bamless.com.chromiumsweupdater.json2022-11-24 10:44 117  
[   ]com.chao.app.json2022-11-23 20:47 117  
[   ]com.corner23.android.beautyclocklivewallpaper.json2022-11-23 19:43 117  
[   ]com.daviancorp.android.monsterhunter3udatabase.json2022-11-23 17:44 117  
[   ]com.hyperionics.fbreader.plugin.tts_plus.json2022-11-23 02:26 117  
[   ]com.porg.gugal.json2022-11-22 06:25 117  
[   ]com.tht.k3pler.json2022-11-21 22:16 117  
[   ]com.zoffcc.applications.metalab_open_widget.json2022-11-21 14:53 117  
[   ]de.nellessen.usercontrolleddecryptionoperations.json2022-11-20 21:39 117  
[   ]jp.co.kayo.android.localplayer.ds.ampache.json2022-11-19 09:16 117  
[   ]me.ash.reader.json2022-11-18 23:06 117  
[   ]me.lucky.volta.json2022-11-18 20:51 117  
[   ]net.kismetwireless.android.smarterwifimanager.json2022-11-18 11:10 117  
[   ]com.tobiaskuban.android.monthcalendarwidgetfoss.json2022-11-21 21:59 118  
[   ]cz.hernik.kaku.json2022-11-21 08:31 118  
[   ]jp.co.kayo.android.localplayer.ds.podcast.json2022-11-19 09:14 118  
[   ]org.dkf.jmule.json2022-11-17 13:22 118  
[   ]org.zamedev.gloomydungeons2.opensource.json2022-11-25 20:18 118  
[   ]rs.ltt.android.json2022-11-25 16:38 118  
[   ]bou.amine.apps.readerforselfossv2.android.json2022-11-24 13:13 119  
[   ]com.anysoftkeyboard.languagepack.afrikaans_oss.json2022-11-24 07:17 119  
[   ]com.anysoftkeyboard.languagepack.hungarian_oss.json2022-11-24 07:15 119  
[   ]com.daemon.ssh.json2022-11-23 18:19 119  
[   ]com.heb12.heb12.json2022-11-23 02:43 119  
[   ]com.holokenmod.json2022-11-23 02:39 119  
[   ]com.matt.bolton.json2022-11-22 16:30 119  
[   ]im.pattle.app.json2022-02-05 11:48 119  
[   ]jl.musicalnotes.json2022-11-19 09:43 119  
[   ]me.lucky.sentry.json2022-11-18 20:51 119  
[   ]net.osmtracker.json2022-11-18 07:56 119  
[   ]com.rechnen.app.json2022-11-22 04:41 120  
[   ]de.ub0r.android.websms.connector.smspilotru.json2022-11-20 15:15 120  
[   ]dk.jens.backup.json2022-11-20 12:54 120  
[   ]me.lucky.duress.json2022-11-18 20:52 120  
[   ]me.thanel.dank.json2022-11-18 20:21 120  
[   ]org.broeuschmeul.android.gps.bluetooth.provider.json2022-11-17 16:10 120  
[   ]org.krita.json2022-11-17 05:26 120  
[   ]org.linphone.json2022-11-17 04:30 120  
[   ]org.sensors2.pd.json2022-11-16 06:00 120  
[   ]ro.ioanm.fissh.json2022-11-25 16:43 120  
[   ]su.xash.husky.json2022-11-25 12:36 120  
[   ]app.olaunchercf.json2022-11-24 15:06 121  
[   ]com.adam.aslfms.json2022-11-24 09:35 121  
[   ]com.aistra.hail.json2022-11-24 09:26 121  
[   ]com.ero.kinoko.json2022-11-23 14:24 121  
[   ]com.headi.app.json2022-11-23 03:10 121  
[   ]com.omelan.cofi.json2022-11-22 08:49 121  
[   ]io.rebble.charon.json2022-11-19 15:12 121  
[   ]is.zi.huewidgets.json2022-11-19 13:02 121  
[   ]juloo.keyboard2.json2022-11-19 08:44 121  
[   ]me.lucky.wasted.json2022-11-18 20:51 121  
[   ]net.gitsaibot.af.json2022-11-18 11:55 121  
[   ]org.mcxa.vortaro.json2022-11-17 01:22 121  
[   ]org.seamapdroid.json2022-11-16 07:23 121  
[   ]cc.calliope.mini.json2022-11-24 12:35 122  
[   ]com.bnyro.trivia.json2022-11-24 00:06 122  
[   ]com.powerje.nyan.json2022-11-22 05:49 122  
[   ]com.slothwerks.hearthstone.compendiumforhearthstone.json2022-11-21 23:49 122  
[   ]com.smithdtyler.prettygoodmusicplayer.launchermode.json2022-11-21 23:46 122  
[   ]de.freehamburger.json2022-11-21 02:27 122  
[   ]de.moekadu.tuner.json2022-11-20 22:36 122  
[   ]miccah.mpvremote.json2022-11-18 19:55 122  
[   ]se.lublin.mumla.json2022-11-25 14:01 122  
[   ]com.adgad.kboard.json2022-11-24 09:34 123  
[   ]com.alovoa.alovoa.json2022-11-24 09:02 123  
[   ]com.aravi.dot.json2022-11-24 06:56 123  
[   ]com.jstephan.yarc.json2022-11-22 23:14 123  
[   ]com.mookie.circo.json2022-11-22 14:55 123  
[   ]com.nicue.onetwo.json2022-11-22 11:53 123  
[   ]de.moroway.oc.json2022-11-20 21:47 123  
[   ]dev.patri9ck.a2ln.json2022-11-20 14:37 123  
[   ]exe.bbllw8.anemo.json2022-11-20 07:49 123  
[   ]me.iacn.mbestyle.json2022-11-18 21:05 123  
[   ]me.jfenn.alarmio.json2022-11-18 20:58 123  
[   ]me.lucky.silence.json2022-11-18 20:51 123  
[   ]net.taler.cashier.json2022-11-17 23:01 123  
[   ]app.varlorg.unote.json2022-11-24 14:56 124  
[   ]com.enrico.sample.json2022-11-23 14:32 124  
[   ]com.itds.sms.ping.json2022-11-23 01:06 124  
[   ]com.notecryptpro.json2022-11-22 10:34 124  
[   ]moe.feng.nhentai.json2022-11-18 18:47 124  
[   ]org.privacyhelper.json2022-11-16 15:00 124  
[   ]ru.gelin.android.weather.notification.skin.blacktext.json2022-11-25 16:11 124  
[   ]ru.gelin.android.weather.notification.skin.whitetext.json2022-11-25 15:48 124  
[   ]app.fedilab.lite.json2021-03-13 09:53 125  
[   ]com.quaap.primary.json2022-11-22 05:26 125  
[   ]com.waist.line.json2022-11-21 16:52 125  
[   ]de.duenndns.gmdice.json2022-11-21 03:17 125  
[   ]in.indiandragon.shellshock.shellshockvulnerabilityscan.json2022-11-19 21:05 125  
[   ]ltd.evilcorp.atox.json2022-11-19 07:10 125  
[   ]mf.asciitext.lite.json2022-11-18 19:55 125  
[   ]moe.matsuri.lite.json2022-11-18 18:43 125  
[   ]net.pp3345.ykdroid.json2022-11-18 01:32 125  
[   ]org.afhdownloader.json2022-11-17 19:33 125  
[   ]org.pgnapps.pk2.json2022-11-16 15:36 125  
[   ]ru.gelin.android.weather.notification.skin.biggertext.json2022-11-25 16:36 125  
[   ]truewatcher.tower.json2022-11-25 11:08 125  
[   ]btools.routingapp.json2022-11-24 13:09 126  
[   ]com.chen.deskclock.json2022-11-23 20:45 126  
[   ]com.dougkeen.bart.json2022-11-23 16:20 126  
[   ]com.gbeatty.arxiv.json2022-11-23 11:13 126  
[   ]com.tailscale.ipn.json2022-11-21 23:06 126  
[   ]com.viper.simplert.json2022-11-21 17:25 126  
[   ]de.baumann.sieben.json2022-11-21 07:19 126  
[   ]de.jepfa.yapm.json2022-11-21 01:17 126  
[   ]it.gmariotti.android.apps.dashclock.extensions.battery.json2022-11-19 11:44 126  
[   ]mattecarra.accapp.json2022-11-19 06:56 126  
[   ]org.anothermonitor.json2022-11-17 18:20 126  
[   ]ademar.textlauncher.json2022-11-24 15:38 127  
[   ]co.prestosole.clima.json2022-11-21 13:35 127  
[   ]com.fmsys.snapdrop.json2022-11-23 12:25 127  
[   ]com.oF2pks.netscope.json2021-03-09 08:40 127  
[   ]com.pjuu.otterdroid.json2022-11-22 06:49 127  
[   ]de.monocles.browser.json2022-11-20 22:36 127  
[   ]dev.lonami.klooni.json2022-11-20 14:53 127  
[   ]eu.quelltext.memory.json2022-11-20 09:01 127  
[   ]it.skarafaz.mercury.json2022-11-19 09:51 127  
[   ]net.xvello.salasana.json2022-11-17 21:57 127  
[   ]org.geometerplus.fbreader.plugin.local_opds_scanner.json2022-11-17 10:18 127  
[   ]org.pixeldroid.app.json2022-11-16 15:27 127  
[   ]org.tessoft.qonvert.json2022-11-26 02:05 127  
[   ]cf.fridays.fff_info.json2022-11-24 12:29 128  
[   ]ch.hgdev.toposuite.json2022-11-24 11:46 128  
[   ]com.jmstudios.chibe.json2022-11-22 23:44 128  
[   ]com.lucao.limpazap.json2022-11-22 18:10 128  
[   ]com.memetro.android.json2022-11-22 16:08 128  
[   ]com.uberspot.a2048.json2022-11-21 19:33 128  
[   ]com.wattwurm.toodoo.json2022-11-21 16:25 128  
[   ]de.blocklink.pigrid.json2022-11-21 05:32 128  
[   ]de.wuapps.moredays.json2022-11-20 13:28 128  
[   ]in.andres.kandroid.json2022-11-19 22:54 128  
[   ]me.echeung.cdflabs.json2022-11-18 21:14 128  
[   ]net.syncthing.lite.json2022-11-17 23:03 128  
[   ]org.floens.chan.json2022-11-17 11:51 128  
[   ]org.stingle.photos.json2022-11-26 04:38 128  
[   ]org.tether.tether.json2022-11-26 02:04 128  
[   ]app.fedilab.tubelab.json2022-11-24 15:23 129  
[   ]com.benny.pxerstudio.json2022-11-24 01:56 129  
[   ]com.lako.walletcount.json2022-11-22 21:17 129  
[   ]com.nyxkn.meditation.json2022-11-22 09:27 129  
[   ]com.pvpc.precio_luz.json2022-11-22 05:45 129  
[   ]com.rfo.LASKmobile.json2022-11-22 04:18 129  
[   ]danielmeek32.compass.json2022-11-21 08:10 129  
[   ]de.determapp.android.json2022-11-21 03:55 129  
[   ]de.grobox.blitzmail.json2022-11-21 02:05 129  
[   ]de.mwvb.blockpuzzle.json2022-11-20 21:44 129  
[   ]de.selfnet.wifisetup.json2022-11-20 19:53 129  
[   ]felixwiemuth.lincal.json2022-11-20 07:48 129  
[   ]fr.emersion.goguma.json2022-11-20 05:45 129  
[   ]oppen.gemini.ariane.json2022-11-17 19:36 129  
[   ]org.biotstoiq.launch.json2022-11-17 16:31 129  
[   ]org.sipdroid.sipua.json2022-11-16 05:24 129  
[   ]org.tengel.timescale.json2022-11-26 02:05 129  
[   ]protect.videoeditor.json2022-11-25 16:54 129  
[   ]ru.hyst329.openfool.json2022-11-25 15:21 129  
[   ]com.android.todolist.json2022-11-24 07:54 130  
[   ]com.dkanada.openapk.json2022-11-23 16:49 130  
[   ]com.looker.droidify.json2022-11-22 18:25 130  
[   ]de.mangelow.debdroid.json2022-11-20 23:09 130  
[   ]eu.mrogalski.saidit.json2022-11-20 10:06 130  
[   ]fr.xtof54.mousetodon.json2022-11-20 02:20 130  
[   ]io.oversec.one.json2022-11-19 15:19 130  
[   ]jackpal.androidterm.json2022-11-19 09:50 130  
[   ]juliushenke.smarttt.json2022-11-19 08:46 130  
[   ]marto.rtl_tcp_andro.json2022-11-19 07:01 130  
[   ]me.dbarnett.acastus.json2022-11-18 21:16 130  
[   ]net.xisberto.timerpx.json2022-11-17 21:59 130  
[   ]org.segin.ttleditor.json2022-11-16 06:02 130  
[   ]science.iodev.fissh.json2022-11-25 14:38 130  
[   ]se.anyro.nfc_reader.json2022-11-25 14:37 130  
[   ]team.swing.pendulums.json2022-11-25 12:14 130  
[   ]top.donmor.tiddloid.json2022-11-25 11:33 130  
[   ]app.fedilab.openmaps.json2022-11-24 15:23 131  
[   ]com.activitymanager.json2022-11-24 09:35 131  
[   ]com.antonok.warpclock.json2022-11-24 07:45 131  
[   ]com.asdoi.quicktiles.json2022-11-24 06:52 131  
[   ]com.biotstoiq.hayago.json2022-11-24 01:11 131  
[   ]com.codedead.deadhash.json2022-11-23 20:16 131  
[   ]com.github.rsteube.t4.json2022-11-23 06:10 131  
[   ]com.mzhang.cleantimer.json2022-11-22 14:06 131  
[   ]com.pato05.uploadgram.json2022-11-22 07:54 131  
[   ]com.smilla.greentooth.json2022-11-21 23:46 131  
[   ]com.starry.greenstash.json2022-11-21 23:34 131  
[   ]info.tangential.cone.json2022-11-19 21:28 131  
[   ]io.github.dkter.aaaaa.json2022-11-19 20:18 131  
[   ]it.vfsfitvnm.vimusic.json2022-11-19 09:51 131  
[   ]jpf.android.magiadni.json2022-11-19 09:03 131  
[   ]net.typeblog.shelter.json2022-11-17 22:40 131  
[   ]org.equeim.tremotesf.json2022-11-17 12:33 131  
[   ]org.poul.bits.android.json2022-11-16 15:23 131  
[   ]org.scoutant.blokish.json2022-11-16 07:23 131  
[   ]org.woheller69.level.json2022-11-25 21:26 131  
[   ]oss.krtirtho.spotube.json2022-11-25 19:47 131  
[   ]se.tube42.p9.android.json2022-11-25 13:54 131  
[   ]com.anoopknr.pastebin.json2022-11-24 07:50 132  
[   ]com.jithware.brethap.json2022-11-23 00:13 132  
[   ]com.sunyata.kindmind.json2022-11-21 23:19 132  
[   ]de.nucleus.foss_warn.json2022-11-20 21:38 132  
[   ]es.wolfi.app.passman.json2022-11-20 11:25 132  
[   ]info.papdt.blackblub.json2022-11-19 21:43 132  
[   ]moe.minori.pgpclipper.json2022-11-18 18:42 132  
[   ]org.transdroid.lite.json2022-11-25 23:51 132  
[   ]org.xposeddownloader.json2022-11-25 20:37 132  
[   ]timur.webcall.callee.json2022-11-25 11:51 132  
[   ]be.knars.netflixtoimdb.json2022-11-24 13:21 133  
[   ]com.cweb.messenger.json2022-11-23 18:46 133  
[   ]com.metinkale.prayer.json2021-03-09 13:14 133  
[   ]com.serwylo.retrowars.json2022-11-22 01:24 133  
[   ]com.tnibler.cryptocam.json2022-11-21 22:05 133  
[   ]com.vladpen.cams.json2022-11-21 17:23 133  
[   ]de.drhoffmannsoftware.json2022-11-21 03:19 133  
[   ]de.gabbo.forro_lyrics.json2022-11-21 02:17 133  
[   ]de.herrmann_engel.rbv.json2022-11-21 01:55 133  
[   ]de.monocles.translator.json2022-11-20 21:47 133  
[   ]de.qwerty287.ftpclient.json2022-11-20 20:43 133  
[   ]me.tripsit.tripmobile.json2022-11-18 20:11 133  
[   ]online.xournal.mobile.json2022-11-17 20:30 133  
[   ]org.freshrss.easyrss.json2022-11-17 10:49 133  
[   ]org.koitharu.kotatsu.json2022-11-17 05:51 133  
[   ]acr.browser.lightning.json2022-11-24 15:45 134  
[   ]br.com.colman.petals.json2022-11-24 13:13 134  
[   ]bus.chio.wishmaster.json2022-11-24 13:07 134  
[   ]chat.rocket.android.json2022-11-24 12:19 134  
[   ]click.dummer.imagesms.json2022-11-24 10:32 134  
[   ]com.blazecode.tsviewer.json2022-11-24 00:33 134  
[   ]com.cityzen.cityzen.json2022-11-23 20:37 134  
[   ]com.dynamite.heaterrc.json2022-11-23 15:48 134  
[   ]com.enrico.earthquake.json2022-11-23 14:34 134  
[   ]com.github.tmo1.sms_ie.json2022-11-23 05:49 134  
[   ]com.saverio.pdfviewer.json2022-11-22 02:37 134  
[   ]de.schildbach.wallet.json2022-11-20 19:57 134  
[   ]io.pslab.json2022-11-19 15:12 134  
[   ]it.danieleverducci.ojo.json2022-11-19 12:32 134  
[   ]it.fossoft.timberfoss.json2022-02-05 01:21 134  
[   ]la.daube.photochiotte.json2022-11-19 07:53 134  
[   ]net.tjado.passwdsafe.json2022-11-17 22:49 134  
[   ]nightlock.peppercarrot.json2022-11-17 21:55 134  
[   ]com.alexkang.loopboard.json2022-11-24 09:03 135  
[   ]com.hobbyone.HashDroid.json2022-11-23 02:40 135  
[   ]com.kgurgul.cpuinfo.json2022-11-22 22:08 135  
[   ]com.mdiqentw.lifedots.json2022-11-22 16:08 135  
[   ]de.j4velin.pedometer.json2022-11-21 01:48 135  
[   ]eu.roggstar.getmitokens.json2022-11-20 08:56 135  
[   ]one.librem.social.json2022-03-20 00:56 135  
[   ]org.fossasia.badgemagic.json2022-11-17 11:45 135  
[   ]org.metabrainz.android.json2022-11-17 01:21 135  
[   ]org.olgsoft.apipepanic.json2022-11-16 20:15 135  
[   ]top.linesoft.open2share.json2022-11-25 11:29 135  
[   ]wtf.technodisaster.tldr.json2022-11-25 09:25 135  
[   ]com.calcitem.sanmill.json2022-11-23 22:24 136  
[   ]com.xabber.androiddev.json2022-11-21 15:30 136  
[   ]de.baumann.quitsmoking.json2022-11-21 07:23 136  
[   ]de.mathema.privacyblur.json2022-11-20 22:53 136  
[   ]de.naturalnet.mirwtfapp.json2022-11-20 21:43 136  
[   ]fr.bellev.stdatmosphere.json2022-11-20 06:51 136  
[   ]godau.fynn.moodledirect.json2022-11-20 01:25 136  
[   ]net.ebt.muzei.miyazaki.json2022-11-18 12:24 136  
[   ]net.taler.wallet.fdroid.json2022-11-17 23:01 136  
[   ]org.courville.nova.json2022-11-17 15:23 136  
[   ]org.pulpdust.lesserpad.json2022-11-16 14:11 136  
[   ]app.fedilab.fedilabtube.json2022-11-24 15:28 137  
[   ]com.anpmech.launcher.json2022-11-24 07:48 137  
[   ]com.cheogram.android.json2022-11-23 20:44 137  
[   ]com.daniel.mobilepauker2.json2022-11-23 18:04 137  
[   ]com.oml.recordtimedroid.json2022-11-22 08:48 137  
[   ]com.quaap.fishberserker.json2022-11-22 05:35 137  
[   ]com.vaudibert.canidrive.json2022-11-21 17:56 137  
[   ]de.drhoffmannsoft.pizza.json2022-11-21 03:19 137  
[   ]gov.anzong.androidnga.json2022-11-20 01:07 137  
[   ]me.wolszon.fastshopping.json2022-11-18 20:03 137  
[   ]net.basov.lws.fdroid.json2022-11-18 12:56 137  
[   ]net.wigle.wigleandroid.json2022-11-17 22:14 137  
[   ]net.xtlive.EDL.Dashboard.json2022-11-17 21:57 137  
[   ]org.alberto97.ouilookup.json2022-11-17 19:30 137  
[   ]org.ninthfloor.copperpdf.json2022-11-16 21:18 137  
[   ]org.opengappsdownloader.json2022-11-16 20:13 137  
[   ]org.unifiedpush.example.json2022-11-25 23:10 137  
[   ]org.zephyrsoft.sdbviewer.json2022-11-25 20:15 137  
[   ]player.efis.data.ant.spl.json2022-11-25 19:41 137  
[   ]protect.babysleepsounds.json2022-11-25 17:19 137  
[   ]rocks.poopjournal.flashy.json2022-11-25 16:47 137  
[   ]slowscript.warpinator.json2022-11-25 13:15 137  
[   ]ua.bossly.tools.translit.json2022-11-25 11:05 137  
[   ]a2dp.Vol.json2022-11-24 15:52 138  
[   ]cloud.valetudo.companion.json2022-11-24 10:24 138  
[   ]com.afollestad.nocknock.json2022-11-24 09:30 138  
[   ]com.blacksquircle.ui.json2022-11-24 01:06 138  
[   ]com.cliambrown.easynoise.json2022-11-23 20:35 138  
[   ]com.fox2code.mmm.fdroid.json2022-11-23 11:56 138  
[   ]com.fsck.k9.material.json2022-11-23 11:22 138  
[   ]com.gabriel.covid19stats.json2022-11-23 11:16 138  
[   ]com.iven.lfflfeedreader.json2022-11-23 01:03 138  
[   ]com.mileskrell.texttorch.json2022-11-22 15:46 138  
[   ]com.noprestige.kanaquiz.json2022-11-22 10:36 138  
[   ]com.redirectapps.tvkill.json2022-11-22 04:39 138  
[   ]com.stoutner.privacycell.json2022-11-21 23:21 138  
[   ]com.torrents_csv_android.json2022-11-21 21:06 138  
[   ]com.vladrip.drgassistant.json2022-11-21 17:17 138  
[   ]com.wownero.wownerujo.json2022-11-21 15:52 138  
[   ]cz.lastaapps.menza.json2022-11-21 08:22 138  
[   ]de.retujo.bierverkostung.json2022-11-20 20:35 138  
[   ]eu.bauerj.paperless_app.json2022-11-20 11:15 138  
[   ]flunzmas.seasoncalendar.json2022-11-20 07:21 138  
[   ]fr.kwiatkowski.ApkTrack.json2022-11-20 04:10 138  
[   ]info.meoblast001.thugaim.json2022-11-19 22:24 138  
[   ]io.gresse.hugo.anecdote.json2022-11-19 16:20 138  
[   ]io.muetsch.anchrandroid.json2022-11-19 15:45 138  
[   ]org.domogik.domodroid13.json2022-11-17 13:17 138  
[   ]org.jfedor.frozenbubble.json2022-11-17 06:56 138  
[   ]org.ligi.gobandroid_hd.json2022-11-17 05:10 138  
[   ]org.openbmap.unifiedNlp.json2022-11-16 20:14 138  
[   ]org.saiditnet.redreader.json2022-11-16 08:02 138  
[   ]org.weilbach.splitbills.json2022-11-25 21:58 138  
[   ]org.yaxim.androidclient.json2022-11-25 20:30 138  
[   ]ro.ciubex.dscautorename.json2022-11-25 16:48 138  
[   ]com.amrdeveloper.linkhub.json2022-11-24 09:01 139  
[   ]com.ominous.quickweather.json2022-11-22 08:48 139  
[   ]com.rabbitcompany.passky.json2022-11-22 05:15 139  
[   ]com.sanzoghenzo.markdownr.json2022-11-22 02:45 139  
[   ]com.shabinder.spotiflyer.json2022-11-22 01:09 139  
[   ]de.live.gdev.cherrymusic.json2022-11-20 23:28 139  
[   ]de.rampro.activitydiary.json2022-11-20 20:39 139  
[   ]eu.bubu1.fdroidclassic.json2022-11-20 11:14 139  
[   ]godau.fynn.bandcampdirect.json2022-11-20 01:43 139  
[   ]io.github.yoshi1123.adbio.json2022-11-19 16:27 139  
[   ]namlit.siteswapgenerator.json2022-11-18 17:39 139  
[   ]org.bitbatzen.wlanscanner.json2022-11-17 16:29 139  
[   ]org.freedombox.freedombox.json2022-11-17 11:23 139  
[   ]org.jellyfin.mobile.json2022-11-17 06:57 139  
[   ]org.kde.bettercounter.json2022-11-17 06:48 139  
[   ]org.sorz.lab.tinykeepass.json2022-11-16 05:01 139  
[   ]superustats.tool.android.json2022-11-25 12:58 139  
[   ]at.or.at.plugoffairplane.json2022-11-24 13:51 140  
[   ]com.dfa.hubzilla_android.json2022-11-23 17:19 140  
[   ]com.example.spokennumbers.json2022-11-23 13:15 140  
[   ]com.lightning.walletapp.json2022-11-22 19:11 140  
[   ]com.manimarank.spell4wiki.json2022-11-22 17:01 140  
[   ]com.saha.batchuninstaller.json2022-11-22 03:49 140  
[   ]com.yassirh.digitalocean.json2022-11-21 15:10 140  
[   ]de.datlag.burningseries.json2022-11-21 04:07 140  
[   ]de.live.gdev.timetracker.json2022-11-20 23:23 140  
[   ]nl.implode.regenalarm.json2022-11-17 21:47 140  
[   ]ru.glesik.wifireminders.json2022-11-25 15:25 140  
[   ]xyz.zedler.patrick.grocy.json2022-11-25 09:00 140  
[   ]br.com.gualandi.dailypill.json2022-11-24 13:11 141  
[   ]cc.narumi.chaldea.fdroid.json2022-11-24 12:33 141  
[   ]com.bijoysingh.quicknote.json2021-03-10 13:04 141  
[   ]com.fr3ts0n.stagefever.json2022-11-23 11:53 141  
[   ]com.jtmcn.archwiki.viewer.json2022-11-22 23:12 141  
[   ]com.marcospoerl.simplypace.json2022-11-22 16:50 141  
[   ]com.matejdro.pebbledialer.json2022-11-22 16:33 141  
[   ]com.ml.proximitysensorfix.json2022-11-22 15:19 141  
[   ]com.zfdang.zsmth_android.json2022-11-21 14:56 141  
[   ]de.ccc.events.badge.card10.json2022-11-21 05:26 141  
[   ]fr.smarquis.sleeptimer.json2022-11-20 02:52 141  
[   ]hu.tagsoft.ttorrent.search.json2022-11-20 00:45 141  
[   ]me.rosuh.easywatermark.json2022-11-18 20:32 141  
[   ]org.bandev.buddhaquotes.json2022-11-17 17:14 141  
[   ]org.benoitharrault.sudoku.json2022-11-17 17:12 141  
[   ]org.pyload.android.client.json2022-11-16 13:43 141  
[   ]org.schabi.jedentageinset.json2022-11-16 08:00 141  
[   ]org.smc.inputmethod.indic.json2022-11-16 05:20 141  
[   ]xyz.zedler.patrick.doodle.json2022-11-25 09:01 141  
[   ]app.librenews.io.librenews.json2022-11-24 15:08 142  
[   ]com.nikola.jakshic.dagger.json2022-11-22 11:44 142  
[   ]com.sanskritbasics.memory.json2022-11-22 02:46 142  
[   ]com.sigmarelax.doitoscihub.json2022-11-22 00:57 142  
[   ]com.xargsgrep.portknocker.json2022-11-21 15:27 142  
[   ]com.yogeshpaliyal.keypass.json2022-11-21 15:09 142  
[   ]de.digisocken.anotherrss.json2022-11-21 03:48 142  
[   ]is.xyz.omw.json2022-11-19 13:53 142  
[   ]net.osmand.srtmPlugin.paid.json2022-11-18 07:59 142  
[   ]net.reichholf.dreamdroid.json2022-11-18 01:05 142  
[   ]org.basketbuilddownloader.json2022-11-17 17:13 142  
[   ]org.billthefarmer.gridle.json2022-11-17 16:47 142  
[   ]org.billthefarmer.gurgle.json2022-11-17 16:46 142  
[   ]org.billthefarmer.solver.json2022-11-17 16:35 142  
[   ]org.billthefarmer.specie.json2022-11-17 16:34 142  
[   ]org.emunix.unipatcher.json2022-03-19 16:11 142  
[   ]org.ligi.materialteatimer.json2022-11-17 05:03 142  
[   ]t20kdc.offlinepuzzlesolver.json2022-11-25 12:16 142  
[   ]com.adityakamble49.dcipher.json2021-03-10 17:21 143  
[   ]com.example.barcodescanner.json2022-11-23 13:29 143  
[   ]com.example.muzei.muzeiapod.json2022-11-23 13:16 143  
[   ]com.ghostsq.commander.sftp.json2022-11-23 10:20 143  
[   ]com.ktprograms.watertracker.json2022-11-22 21:41 143  
[   ]com.nathaniel.motus.cavevin.json2022-11-22 13:55 143  
[   ]com.szchoiceway.aios.bridge.json2022-11-21 23:07 143  
[   ]com.tobykurien.google_news.json2022-11-21 21:58 143  
[   ]de.cloneapps.crypto_prices.json2022-11-21 05:00 143  
[   ]de.eknoes.inofficialgolem.json2022-11-21 03:08 143  
[   ]de.hosenhasser.funktrainer.json2022-11-21 01:49 143  
[   ]espero.jiofibatterynotifier.json2022-11-20 11:30 143  
[   ]eu.veldsoft.hungarian.rings.json2022-11-20 08:03 143  
[   ]open.com.permissionsmanager.json2022-11-17 20:30 143  
[   ]org.andresoviedo.dddmodel2.json2022-11-17 19:07 143  
[   ]org.woheller69.audiometry.json2022-11-25 21:28 143  
[   ]org.woheller69.spritpreise.json2022-11-25 21:26 143  
[   ]com.ahorcado.json2022-11-24 09:26 144  
[   ]com.gitlab.terrakok.gitfox.json2022-11-23 05:25 144  
[   ]com.nextcloud.client.json2022-11-22 13:29 144  
[   ]com.nononsenseapps.wanidoku.json2022-11-22 10:39 144  
[   ]de.schildbach.wallet_test.json2022-11-20 19:54 144  
[   ]fr.fdesousa.bikesharinghub.json2022-11-20 05:45 144  
[   ]m.co.rh.id.a_news_provider.json2022-11-18 23:26 144  
[   ]org.cry.otp.json2022-11-17 14:47 144  
[   ]org.lufebe16.pysolfc.json2022-11-17 03:43 144  
[   ]au.com.wallaceit.reddinator.json2022-11-24 13:33 145  
[   ]com.bernaferrari.sdkmonitor.json2022-11-24 01:46 145  
[   ]com.denytheflowerpot.scrunch.json2022-11-23 17:24 145  
[   ]com.gacode.relaunchx.json2022-11-23 11:15 145  
[   ]com.jeroen1602.lighthouse_pm.json2022-11-23 00:13 145  
[   ]com.manuelvargastapia.libgen.json2022-11-22 16:54 145  
[   ]com.polar.nextcloudservices.json2022-11-22 06:27 145  
[   ]com.rohitsuratekar.NCBSinfo.json2022-11-22 03:56 145  
[   ]com.tananaev.passportreader.json2022-11-21 22:53 145  
[   ]com.uploadedlobster.PwdHash.json2022-11-21 18:07 145  
[   ]de.qspool.clementineremote.json2022-11-20 20:46 145  
[   ]de.vier_bier.habpanelviewer.json2022-11-20 15:08 145  
[   ]org.strawberryforum.argentum.json2022-11-26 04:32 145  
[   ]org.thiolliere.youtubestream.json2022-11-26 01:53 145  
[   ]org.xcsoar.json2022-11-25 20:52 145  
[   ]at.tacticaldevc.panictrigger.json2022-11-24 13:51 146  
[   ]click.dummer.UartSmartwatch.json2022-11-24 10:25 146  
[   ]com.MarcosDiez.shareviahttp.json2022-11-22 16:52 146  
[   ]com.donnnno.arcticons.light.json2022-11-23 16:45 146  
[   ]com.kanedias.holywarsoo.json2022-11-22 22:28 146  
[   ]com.marceljurtz.lifecounter.json2022-11-22 16:53 146  
[   ]com.thibaudperso.sonycamera.json2022-11-21 22:18 146  
[   ]com.tobykurien.webmediashare.json2022-11-21 21:29 146  
[   ]com.vonglasow.michael.qz.json2022-11-21 17:02 146  
[   ]me.austinhuang.instagrabber.json2022-11-18 23:03 146  
[   ]net.i2p.android.router.json2022-11-18 11:23 146  
[   ]org.bienvenidoainternet.app.json2022-11-17 17:09 146  
[   ]org.openintents.filemanager.json2022-11-16 18:24 146  
[   ]co.garmax.materialflashlight.json2022-11-24 09:59 147  
[   ]com.flx_apps.digitaldetox.json2022-11-23 12:26 147  
[   ]com.github.ktsr42.rsyncserver.json2022-11-23 07:16 147  
[   ]com.github.moko256.twitlatte.json2022-11-23 07:02 147  
[   ]com.haringeymobile.ukweather.json2022-11-23 03:14 147  
[   ]com.manimarank.websitemonitor.json2022-11-22 16:57 147  
[   ]com.noahjutz.splitfit.fdroid.json2022-11-22 11:37 147  
[   ]com.smartpack.kernelprofiler.json2022-11-21 23:47 147  
[   ]com.thirtydegreesray.openhub.json2022-11-21 22:17 147  
[   ]de.drmaxnix.birthdaycountdown.json2022-11-21 03:18 147  
[   ]de.markusfisch.android.libra.json2022-11-20 23:07 147  
[   ]eu.veldsoft.ithaka.board.game.json2022-11-20 08:03 147  
[   ]grmpl.mk.stepandheightcounter.json2022-11-20 01:06 147  
[   ]inc.flide.vi8.json2022-11-19 22:50 147  
[   ]me.billdietrich.fake_contacts.json2022-11-18 22:59 147  
[   ]org.avmedia.gshockGoogleSync.json2022-11-17 17:16 147  
[   ]org.olpc_france.sugarizer.json2022-11-16 20:15 147  
[   ]org.openintents.shopping.json2022-11-16 18:20 147  
[   ]x653.bullseye.json2022-11-25 09:21 147  
[   ]com.foobnix.pro.pdf.reader.json2022-11-23 12:25 148  
[   ]com.nhellfire.kerneladiutor.json2022-11-22 11:56 148  
[   ]de.hoffmannsgimmickstaupunkt.json2022-11-21 01:50 148  
[   ]de.vanitasvitae.enigmandroid.json2022-11-20 15:11 148  
[   ]godau.fynn.usagedirect.system.json2022-11-20 01:15 148  
[   ]mobi.maptrek.json2022-11-18 18:58 148  
[   ]org.kontalk.json2022-11-17 05:42 148  
[   ]org.mozilla.mozstumbler.json2022-11-16 21:34 148  
[   ]subreddit.android.appstore.json2022-11-25 13:05 148  
[   ]uk.co.richyhbm.monochromatic.json2022-11-25 09:58 148  
[   ]com.confinement.diconfinement.json2022-11-23 19:43 149  
[   ]com.nicolasbrailo.vlcfreemote.json2022-11-22 11:53 149  
[   ]com.tomatodev.timerdroid.json2022-11-21 21:15 149  
[   ]com.trianguloy.clipboardeditor.json2022-11-21 20:49 149  
[   ]de.bulling.barcodebuddyscanner.json2022-11-21 05:30 149  
[   ]de.micmun.android.deufeitage.json2022-11-20 22:37 149  
[   ]in.sunilpaulmathew.izzyondroid.json2022-11-19 21:01 149  
[   ]nl.eventinfra.wifisetup.json2022-11-17 21:47 149  
[   ]org.libreoffice.impressremote.json2022-11-17 05:19 149  
[   ]phone.vishnu.dialogmusicplayer.json2022-11-25 19:42 149  
[   ]tech.platypush.platypush.json2022-11-25 12:12 149  
[   ]click.dummer.notify_to_jabber.json2022-11-24 10:31 150  
[   ]com.anddevw.getchromium.json2022-11-24 09:01 150  
[   ]com.fediphoto.json2022-11-23 12:43 150  
[   ]com.gmail.jiwopene.temperature.json2022-11-23 05:16 150  
[   ]de.tobiasbielefeld.brickgames.json2022-11-20 16:58 150  
[   ]io.github.project_travel_mate.json2022-02-05 05:14 150  
[   ]org.blokada.fem.fdroid.json2022-11-17 16:19 150  
[   ]org.notabug.lifeuser.moviedb.json2022-11-16 20:35 150  
[   ]org.qosp.notes.json2022-11-16 13:27 150  
[   ]rocks.poopjournal.vacationdays.json2022-11-25 16:47 150  
[   ]com.asksven.betterbatterystats.json2022-11-24 06:49 151  
[   ]com.punksta.apps.volumecontrol.json2022-11-22 05:46 151  
[   ]com.zola.bmi.json2022-11-21 13:47 151  
[   ]in.blogspot.anselmbros.torchie.json2022-11-19 22:50 151  
[   ]io.github.z3r0c00l_2k.aquadroid.json2022-11-19 16:27 151  
[   ]org.fitchfamily.android.dejavu.json2022-11-17 12:01 151  
[   ]org.liberty.android.freeotpplus.json2022-11-17 05:21 151  
[   ]taco.apkmirror.json2022-11-25 12:15 151  
[   ]com.darkempire78.opencalculator.json2022-11-23 18:04 152  
[   ]com.decred.decredaddressscanner.json2022-11-23 17:24 152  
[   ]d.d.meshenger.json2022-11-21 08:09 152  
[   ]de.jepfa.personaltasklogger.json2022-11-21 01:25 152  
[   ]fr.jnda.android.ipcalc.json2022-11-20 04:13 152  
[   ]in.amfoss.raag.json2022-11-19 23:28 152  
[   ]io.github.chronosx88.yggdrasil.json2022-11-19 20:34 152  
[   ]io.github.hidroh.materialistic.json2022-11-19 19:03 152  
[   ]link.standen.michael.fatesheets.json2022-11-19 07:24 152  
[   ]me.anon.grow.json2022-11-18 23:12 152  
[   ]org.pipoypipagames.towerjumper.json2022-11-16 15:31 152  
[   ]com.ominous.batterynotification.json2022-11-22 08:48 153  
[   ]de.metager.metagerapp.fdroid.json2022-11-20 22:37 153  
[   ]de.thefeiter.liedgutverzeichnis.json2022-11-20 17:00 153  
[   ]link.standen.michael.phonesaver.json2022-11-19 07:19 153  
[   ]menion.android.whereyougo.json2022-11-18 20:34 153  
[   ]org.getdisconnected.libreipsum.json2022-11-17 10:12 153  
[   ]us.spotco.maps.json2022-11-25 09:46 153  
[   ]ca.rmen.android.scrumchatter.json2022-11-24 12:46 154  
[   ]ca.snoe.deedum.json2022-11-24 12:43 154  
[   ]ch.deletescape.lawnchair.plah.json2022-11-24 11:48 154  
[   ]com.jovial.jrpn.json2022-11-22 23:17 154  
[   ]com.orpheusdroid.screenrecorder.json2022-11-22 08:35 154  
[   ]com.vonglasow.michael.satstat.json2022-11-21 16:58 154  
[   ]com.zoffcc.applications.zanavi.json2022-11-21 13:53 154  
[   ]de.freifunk_karte.freifunk_karte.json2022-11-21 02:18 154  
[   ]fr.unix_experience.owncloud_sms.json2022-11-20 02:25 154  
[   ]info.guardianproject.pixelknot.json2022-11-19 22:26 154  
[   ]io.va.exposed.json2022-11-19 14:54 154  
[   ]org.astonbitecode.rustkeylock.json2022-11-17 17:57 154  
[   ]android.nachiketa.ebookdownloader.json2022-11-24 15:31 155  
[   ]com.jairaj.janglegmail.motioneye.json2022-11-23 00:56 155  
[   ]com.tasomaniac.openwith.floss.json2022-11-21 22:52 155  
[   ]com.toxtox.philosopherstonewidget.json2022-11-21 20:59 155  
[   ]cz.jirkovsky.lukas.chmupocasi.json2022-11-21 08:27 155  
[   ]de.clemensbartz.android.launcher.json2022-11-21 05:12 155  
[   ]wangdaye.com.geometricweather.json2022-11-25 09:43 155  
[   ]at.h4x.awhip.json2022-11-24 13:58 156  
[   ]com.bernaferrari.changedetection.json2022-11-24 01:48 156  
[   ]es.usc.citius.servando.calendula.json2022-02-05 21:12 156  
[   ]io.github.muntashirakon.Music.json2022-11-19 17:49 156  
[   ]nl.viter.glider.json2022-11-17 21:33 156  
[   ]org.scoutant.rpn.json2022-11-16 07:23 156  
[   ]org.sensors2.osc.json2022-11-16 06:01 156  
[   ]org.surrel.facebooknotifications.json2022-11-26 03:48 156  
[   ]uk.co.yahoo.p1rpp.calendartrigger.json2022-11-25 09:58 156  
[   ]za.co.lukestonehm.logicaldefence.json2022-11-25 08:55 156  
[   ]ca.rmen.android.networkmonitor.json2022-11-24 12:50 157  
[   ]com.dosse.bwentrain.androidPlayer.json2022-11-23 16:27 157  
[   ]com.elsdoerfer.android.autostarts.json2022-11-23 14:37 157  
[   ]com.jarsilio.android.waveup.tasker.json2022-11-23 00:34 157  
[   ]com.transway.caresteouvert.json2022-11-21 20:49 157  
[   ]com.tserumula.dbcleanerforwhatsapp.json2022-11-21 20:47 157  
[   ]org.jdfossapps.android.shopwithmom.json2022-11-17 06:57 157  
[   ]org.microg.nlp.backend.ichnaea.json2022-11-17 00:49 157  
[   ]org.ogre.browser.json2022-11-16 20:22 157  
[   ]com.github.linwoodcloud.dev_doctor.json2022-11-23 07:16 158  
[   ]com.github.muellerma.mute_reminder.json2022-11-23 06:59 158  
[   ]de.thecode.android.tazreader.json2022-11-20 17:22 158  
[   ]net.ddns.mlsoftlaberge.trycorder.json2022-11-18 12:25 158  
[   ]net.ivpn.client.json2022-11-18 11:17 158  
[   ]rodrigodavy.com.github.pixelartist.json2022-11-25 16:44 158  
[   ]ch.famoser.mensa.json2022-11-24 11:47 159  
[   ]com.bobek.compass.json2022-11-23 23:53 159  
[   ]com.brentpanther.bitcoincashwidget.json2022-11-23 23:03 159  
[   ]com.dosse.dozeoff.json2022-11-23 16:24 159  
[   ]com.dozingcatsoftware.cardswithcats.json2022-11-23 16:17 159  
[   ]com.gmail.anubhavdas54.whatsdeleted.json2022-11-23 05:22 159  
[   ]com.mbestavros.geometricweather.json2022-11-22 16:11 159  
[   ]com.minar.birday.json2022-11-22 15:43 159  
[   ]com.readrops.app.json2022-11-22 04:41 159  
[   ]fr.mobdev.goblim.json2022-11-20 03:53 159  
[   ]io.infinyte7.ankiimageocclusion.json2022-11-19 15:52 159  
[   ]org.secuso.privacyfriendlysketching.json2022-11-16 06:32 159  
[   ]pl.edu.pjwstk.s999844.shoppinglist.json2022-11-25 19:18 159  
[   ]com.antoniotari.reactiveampacheapp.json2022-11-24 07:46 160  
[   ]com.chancehorizon.just24hoursplus.json2022-11-23 20:47 160  
[   ]de.baumann.thema.json2022-11-21 07:14 160  
[   ]de.kromke.andreas.cameradatefolders.json2022-11-21 00:36 160  
[   ]de.spiritcroc.defaultdarktheme_oms.json2022-11-20 19:30 160  
[   ]info.metadude.android.rc3.schedule.json2022-11-19 21:46 160  
[   ]info.varden.hauk.json2022-11-19 21:23 160  
[   ]net.artificialworlds.rabbitescape.json2022-11-18 13:01 160  
[   ]net.osmand.plus.json2022-11-18 08:09 160  
[   ]org.proninyaroslav.blink_comparison.json2022-11-16 14:30 160  
[   ]com.joshuacerdenia.android.nicefeed.json2022-11-22 23:21 161  
[   ]com.leinardi.ubuntucountdownwidget.json2022-11-22 20:25 161  
[   ]com.termux.widget.json2022-11-21 22:27 161  
[   ]com.therealbluepandabear.pixapencil.json2022-11-21 22:24 161  
[   ]net.justdave.nwsweatheralertswidget.json2022-11-18 11:11 161  
[   ]ro.radioromaniaactualitati.podcasts.json2022-11-25 16:38 161  
[   ]at.h4x.metaapp.json2022-11-24 13:58 162  
[   ]com.anysoftkeyboard.languagepack.neo.json2022-11-24 07:13 162  
[   ]com.github.doomsdayrs.apps.shosetsu.json2022-11-23 07:43 162  
[   ]com.github.muellerma.prepaidbalance.json2022-11-23 06:57 162  
[   ]com.tortel.syslog.json2022-11-21 21:02 162  
[   ]io.github.muntashirakon.AppManager.json2022-11-19 18:16 162  
[   ]io.github.subhamtyagi.privacyapplock.json2022-11-19 17:10 162  
[   ]org.microg.nlp.backend.nominatim.json2022-11-17 00:48 162  
[   ]org.sufficientlysecure.localcalendar.json2022-11-26 04:00 162  
[   ]ca.rmen.nounours.json2022-11-24 12:45 163  
[   ]ch.bubendorf.locusaddon.gsakdatabase.json2022-11-24 11:56 163  
[   ]com.martinmimigames.littlemusicplayer.json2022-11-22 16:46 163  
[   ]de.micmun.android.nextcloudcookbook.json2022-11-20 22:36 163  
[   ]de.monocles.chat.json2022-11-20 22:06 163  
[   ]fr.covidat.android.json2022-11-20 06:48 163  
[   ]org.secuso.privacyfriendlywifimanager.json2022-11-16 06:09 163  
[   ]org.unifiedpush.distributor.nextpush.json2022-11-25 23:11 163  
[   ]com.blogspot.e_kanivets.moneytracker.json2022-11-24 00:15 164  
[   ]de.c3nav.droid.json2022-11-21 05:29 164  
[   ]de.hirtenstrasse.michael.lnkshortener.json2022-11-21 01:53 164  
[   ]de.yaacc.json2022-11-20 12:59 164  
[   ]eu.depau.etchdroid.json2022-11-20 11:14 164  
[   ]org.herrlado.ask.languagepack.czech.json2022-11-17 08:28 164  
[   ]ch.blinkenlights.android.vanillaplug.json2022-11-24 11:56 165  
[   ]com.adonai.manman.json2022-11-24 09:31 165  
[   ]com.angrydoughnuts.android.alarmclock.json2022-11-24 07:50 165  
[   ]com.dar.nclientv2.json2022-11-23 18:00 165  
[   ]com.dosse.speedtest.json2022-11-23 16:24 165  
[   ]io.github.subhamtyagi.quickcalculation.json2022-11-19 17:09 165  
[   ]jp.takke.datastats.json2022-11-19 08:48 165  
[   ]kaba.yucata.envoy.json2022-11-19 08:37 165  
[   ]mono.hg.json2022-11-18 18:40 165  
[   ]net.moasdawiki.app.json2022-11-18 10:04 165  
[   ]org.jitsi.meet.json2022-11-17 06:50 165  
[   ]ru.gelin.android.weather.notification.json2022-11-25 16:36 165  
[   ]subins2000.manglish.json2022-11-25 13:08 165  
[   ]co.appreactor.news.json2022-11-24 10:12 166  
[   ]com.github.livingwithhippos.unchained.json2022-11-23 07:16 166  
[   ]deep.ryd.rydplayer.json2022-11-21 02:39 166  
[   ]ga.testapp.testapp.json2022-11-20 02:13 166  
[   ]org.pocketworkstation.pckeyboard.json2022-11-16 15:26 166  
[   ]org.secuso.privacyfriendlyyahtzeedicer.json2022-11-16 06:07 166  
[   ]com.lolo.io.onelist.json2022-11-22 18:29 167  
[   ]com.tananaev.logcat.json2022-11-21 23:00 167  
[   ]io.github.tjg1.nori.json2022-11-19 17:08 167  
[   ]net.vonforst.evmap.json2022-11-17 22:39 167  
[   ]org.kaqui.json2022-11-17 06:49 167  
[   ]org.kknickkk.spider.json2022-11-17 05:51 167  
[   ]app.crossword.yourealwaysbe.forkyz.json2022-11-24 15:29 168  
[   ]com.anysoftkeyboard.languagepack.dutch.json2022-11-24 07:17 168  
[   ]com.better.alarm.json2022-11-24 01:38 168  
[   ]com.danhasting.radar.json2022-11-23 18:16 168  
[   ]com.jstappdev.dbclf.json2022-11-22 23:14 168  
[   ]com.marcdonald.hibi.json2022-11-22 16:54 168  
[   ]com.nazmar.dicegainz.json2022-11-22 13:54 168  
[   ]com.nighthawkapps.wallet.android.json2022-11-22 11:52 168  
[   ]com.omgodse.notally.json2022-11-22 08:49 168  
[   ]com.superproductivity.superproductivity.json2022-11-21 23:18 168  
[   ]com.vlille.checker.json2022-11-21 17:09 168  
[   ]info.tangential.task.json2022-11-19 21:25 168  
[   ]net.guildem.publicip.json2022-11-18 11:25 168  
[   ]org.dystopia.email.json2022-11-17 12:57 168  
[   ]org.galexander.sshd.json2022-11-17 10:45 168  
[   ]xyz.deepdaikon.quinb.json2022-11-25 09:16 168  
[   ]com.arnaud.metronome.json2022-11-24 06:55 169  
[   ]org.atalk.android.json2022-11-17 17:38 169  
[   ]org.secuso.privacyfriendlyfinancemanager.json2022-11-16 07:14 169  
[   ]com.anysoftkeyboard.languagepack.basque.json2022-11-24 07:17 170  
[   ]com.anysoftkeyboard.languagepack.greek.json2022-11-24 07:16 170  
[   ]com.aefyr.sai.fdroid.json2022-11-24 09:30 171  
[   ]com.gianlu.aria2app.json2022-11-23 10:15 171  
[   ]com.oF2pks.chairlock.json2022-11-22 09:05 171  
[   ]com.palliser.nztides.json2022-11-22 08:01 171  
[   ]com.yubico.yubioath.json2022-11-21 15:09 171  
[   ]fr.nihilus.music.json2022-11-20 03:47 171  
[   ]net.pfiers.osmfocus.json2022-11-18 02:10 171  
[   ]one.librem.mail.json2022-03-20 00:57 171  
[   ]swati4star.createpdf.json2022-11-25 12:28 171  
[   ]us.spotco.extirpater.json2022-11-25 09:47 171  
[   ]us.spotco.motionlock.json2022-11-25 09:46 171  
[   ]be.mygod.vpnhotspot.json2021-04-02 08:27 172  
[   ]com.anysoftkeyboard.languagepack.danish.json2022-11-24 07:17 172  
[   ]com.anysoftkeyboard.languagepack.german.json2022-11-24 07:16 172  
[   ]com.anysoftkeyboard.languagepack.hebrew.json2022-11-24 07:15 172  
[   ]com.cgogolin.library.json2022-11-23 22:08 172  
[   ]com.enrico.earthquake.batterysimplysolid.json2022-11-23 14:33 172  
[   ]com.freerdp.afreerdp.json2022-11-23 11:45 172  
[   ]com.github.shadowsocks.plugin.v2ray.json2022-11-23 06:03 172  
[   ]com.serwylo.babyphone.json2022-11-22 01:33 172  
[   ]foss.cnugteren.nlweer.json2022-11-20 07:18 172  
[   ]org.petero.droidfish.json2022-11-16 15:40 172  
[   ]ca.cmetcalfe.xposed.disablebatterywarnings.json2022-11-24 13:04 173  
[   ]com.fr3ts0n.androbd.plugin.gpsprovider.json2022-11-23 11:55 173  
[   ]com.github.jameshnsears.quoteunquote.json2022-11-23 07:19 173  
[   ]app.crescentcash.src.json2022-11-24 15:29 174  
[   ]com.anysoftkeyboard.languagepack.italian.json2022-11-24 07:14 174  
[   ]com.anysoftkeyboard.languagepack.latvian.json2022-11-24 07:14 174  
[   ]com.freshollie.monkeyboard.keystoneradio.json2022-11-23 11:38 174  
[   ]com.kazufukurou.nanji.json2022-11-22 22:20 174  
[   ]com.knirirr.beecount.json2022-11-22 21:57 174  
[   ]com.vadimfrolov.duorem.json2022-11-21 17:59 174  
[   ]de.devmil.muzei.bingimageofthedayartsource.json2022-11-21 03:53 174  
[   ]dev.leonlatsch.photok.json2022-11-20 14:54 174  
[   ]godau.fynn.usagedirect.json2022-11-20 01:16 174  
[   ]net.kollnig.missioncontrol.fdroid.json2022-11-18 11:10 174  
[   ]org.transdroid.search.json2022-11-25 23:48 174  
[   ]de.simplestatswidget.json2022-11-20 19:45 175  
[   ]es.ideotec.workouttime.json2022-11-20 11:31 175  
[   ]org.amoradi.syncopoli.json2022-11-17 19:08 175  
[   ]org.ea.sqrl.json2022-11-17 12:56 175  
[   ]quickly.quit.json2022-11-25 16:53 175  
[   ]streetwalrus.usbmountr.json2022-11-25 13:08 175  
[   ]com.anysoftkeyboard.languagepack.russian2.json2022-11-24 07:11 176  
[   ]com.enjoyingfoss.feeel.json2022-11-23 14:35 176  
[   ]com.ruesga.android.wallpapers.photophase.json2022-11-22 03:51 176  
[   ]org.broeuschmeul.android.gps.usb.provider.json2022-11-17 16:09 176  
[   ]org.schabi.nxbookmarks.json2022-11-16 07:32 176  
[   ]pro.kherel.selfprivacy.json2022-11-25 17:22 176  
[   ]aq.metallists.loudbang.json2022-11-24 14:54 177  
[   ]com.LAPARCELA.nihonoari.json2022-11-22 21:12 177  
[   ]com.abhijitvalluri.android.fitnotifications.json2022-11-24 09:48 177  
[   ]com.anysoftkeyboard.languagepack.hungarian.json2022-11-24 07:15 177  
[   ]com.damiengo.websiterss.json2022-11-23 18:17 177  
[   ]com.darshancomputing.BatteryIndicatorPro.json2022-11-23 17:59 177  
[   ]com.iatfei.streakalarm.json2022-11-23 02:22 177  
[   ]com.inspiredandroid.linuxcommandbibliotheca.json2022-11-23 01:33 177  
[   ]eu.roggstar.luigithehunter.batterycalibrate.json2022-11-20 08:56 177  
[   ]ogz.tripeaks.json2022-11-17 21:08 177  
[   ]org.andstatus.game2048.json2022-11-17 18:20 177  
[   ]org.mfri.bbcworldservicenewshourdownloader.json2022-11-17 01:17 177  
[   ]ac.robinson.mediaphone.json2022-11-24 15:40 178  
[   ]com.anysoftkeyboard.languagepack.brazilian.json2022-11-24 07:17 178  
[   ]com.anysoftkeyboard.languagepack.norwegian.json2022-11-24 07:13 178  
[   ]com.launcher.silverfish.json2022-11-22 21:09 178  
[   ]fr.witchdoctors.c4ffein.oosfirmwareextractor.json2022-11-20 02:23 178  
[   ]info.schnatterer.nusic.json2022-11-19 21:34 178  
[   ]org.dicio.dicio_android.json2022-11-17 13:49 178  
[   ]org.purple.smoke.json2022-11-16 13:56 178  
[   ]se.leap.bitmaskclient.json2022-11-25 14:17 178  
[   ]simple.reboot.com.json2022-11-25 13:36 178  
[   ]com.fr3ts0n.androbd.plugin.sensorprovider.json2022-11-23 11:54 179  
[   ]com.servoz.appsdisabler.json2022-11-22 01:33 179  
[   ]com.tananaev.calculator.json2022-11-21 23:01 179  
[   ]com.anysoftkeyboard.languagepack.portuguese.json2022-11-24 07:12 180  
[   ]com.gianlu.aria2android.json2022-11-23 10:17 180  
[   ]com.pilot51.voicenotify.json2022-11-22 07:09 180  
[   ]com.shkmishra.lyrically.json2022-11-22 01:03 180  
[   ]io.github.sds100.keymapper.inputmethod.latin.json2022-11-19 17:35 180  
[   ]org.adaway.json2022-11-17 19:33 180  
[   ]org.woheller69.eggtimer.json2022-11-25 21:28 180  
[   ]player.efis.data.pan.arg.json2022-11-25 19:32 180  
[   ]rocks.poopjournal.todont.json2022-11-25 16:47 180  
[   ]fr.mobdev.blooddonation.json2022-11-20 03:56 181  
[   ]io.github.lufte.lona.json2022-11-19 18:39 181  
[   ]org.indywidualni.fblite.json2022-11-17 07:54 181  
[   ]threads.thor.json2022-11-25 11:52 181  
[   ]name.seguri.android.lock.json2022-11-18 17:41 182  
[   ]com.atr.tedit.json2022-11-24 06:46 183  
[   ]com.bytestemplar.tonedef.json2022-11-23 22:24 183  
[   ]com.mcsnowflake.worktimer.json2022-11-22 16:11 183  
[   ]com.sleeptimer.json2022-11-21 23:49 183  
[   ]de.hampager.dapnetmobile.json2022-11-21 01:55 183  
[   ]de.nproth.pin.json2022-11-20 21:38 183  
[   ]com.abhinavmarwaha.wrotto.json2022-11-24 09:39 184  
[   ]com.securefilemanager.app.json2022-11-22 01:38 184  
[   ]com.vecturagames.android.app.passwordgenerator.json2022-11-21 17:52 184  
[   ]android.jonas.fakestandby.json2022-11-24 15:32 185  
[   ]ru.seva.finder.json2022-11-25 15:00 185  
[   ]com.nltechno.dolidroidpro.json2022-11-22 11:38 186  
[   ]com.sduduzog.slimlauncher.json2022-11-22 02:26 186  
[   ]com.tomer.screenshotsharer.json2022-11-21 21:06 186  
[   ]me.zhanghai.android.files.json2022-11-18 19:55 186  
[   ]anupam.acrylic.json2022-11-24 15:30 187  
[   ]com.apk.editor.json2022-11-24 07:09 187  
[   ]com.commit451.gitlab.json2022-11-23 19:56 187  
[   ]com.ensoft.imgurviewer.json2022-11-23 14:31 187  
[   ]com.ferrarid.converterpro.json2022-11-23 12:37 187  
[   ]com.lavadip.miniVector.json2022-11-22 20:46 187  
[   ]com.quaap.bookymcbookface.json2022-11-22 05:39 187  
[   ]com.vwp.owmap.json2022-11-21 16:53 187  
[   ]in.shick.diode.json2022-11-19 21:02 187  
[   ]io.heckel.ntfy.json2022-11-19 16:18 187  
[   ]jp.ddo.hotmist.unicodepad.json2022-11-19 09:04 187  
[   ]net.sourceforge.x11basic.json2022-11-17 23:07 187  
[   ]org.docspell.docspellshare.json2022-11-17 13:18 187  
[   ]com.concept1tech.instalate.json2022-11-23 19:48 188  
[   ]com.ebaschiera.triplecamel.json2022-11-23 15:33 188  
[   ]com.timenotclocks.bookcase.json2022-11-21 22:14 188  
[   ]pro.rudloff.openvegemap.json2022-11-25 17:20 188  
[   ]ch.protonvpn.android.json2022-11-24 11:30 189  
[   ]com.akdev.nofbeventscraper.json2022-11-24 09:26 189  
[   ]com.maltaisn.notes.sync.json2022-11-22 17:16 189  
[   ]info.spotcomms.wlanbackend.json2022-11-19 21:28 189  
[   ]net.nitratine.priceperunit.json2022-11-18 09:22 189  
[   ]ohi.andre.consolelauncher.json2022-11-17 21:07 189  
[   ]theredspy15.ltecleanerfoss.json2022-11-25 11:52 189  
[   ]es.eoinrul.ecwt.json2022-11-20 11:33 190  
[   ]eu.pretix.pretixscan.droid.json2022-11-20 09:14 190  
[   ]me.wenxinwang.pulsedroidrtp.json2022-11-18 20:07 190  
[   ]de.saschahlusiak.freebloks.json2022-11-20 20:01 191  
[   ]nl.implode.weer.json2022-11-17 21:45 191  
[   ]com.buzbuz.smartautoclicker.json2022-11-23 22:40 192  
[   ]com.bytehamster.flowitgame.json2022-11-23 22:28 192  
[   ]com.lithium.leona.openstud.json2022-11-22 19:02 192  
[   ]com.luk.saucenao.json2022-11-22 18:03 192  
[   ]com.machiav3lli.derdiedas.json2022-11-22 17:50 192  
[   ]com.mschlauch.comfortreader.json2022-11-22 14:21 192  
[   ]com.practicalapps.hamtrainer.json2022-11-22 05:47 192  
[   ]com.smartpack.scriptmanager.json2022-11-21 23:47 192  
[   ]de.sudoq.json2022-11-20 18:30 192  
[   ]dev.patrickgold.florisboard.json2022-11-20 14:30 192  
[   ]net.nhiroki.bluelineconsole.json2022-11-18 09:22 192  
[   ]org.sufficientlysecure.ical.json2022-11-26 04:25 192  
[   ]de.wikilab.android.ldapsync.json2022-11-20 13:33 193  
[   ]info.guardianproject.ripple.json2022-11-19 22:25 194  
[   ]site.leos.setter.json2022-11-25 13:18 194  
[   ]com.aaronjwood.portauthority.json2022-11-24 09:54 195  
[   ]com.aurora.adroid.json2022-11-24 06:46 195  
[   ]com.dp.logcatapp.json2022-11-23 16:05 195  
[   ]com.emanuelef.remote_capture.json2022-11-23 14:36 195  
[   ]com.gianlu.pretendyourexyzzy.json2022-11-23 10:12 195  
[   ]com.philolog.hoplitekeyboard.json2022-11-22 07:24 195  
[   ]com.sesu8642.infusion_timer.json2022-11-22 01:17 195  
[   ]com.smartpack.kernelmanager.json2022-11-21 23:47 195  
[   ]com.termux.tasker.json2022-11-21 22:27 195  
[   ]de.drhoffmannsoftware.calcvac.json2022-11-21 03:19 195  
[   ]de.mw136.tonuino.json2022-11-20 21:44 195  
[   ]posidon.launcher.json2022-11-25 17:34 195  
[   ]com.gitlab.dibdib.dib2calc.json2022-11-23 05:25 196  
[   ]com.mde.potdroid.json2022-11-22 16:09 196  
[   ]com.slash.batterychargelimit.json2022-11-21 23:53 196  
[   ]de.tobiasbielefeld.solitaire.json2022-11-20 16:51 196  
[   ]luke.launcher.json2022-11-19 07:05 196  
[   ]net.dcnnt.json2022-11-18 12:26 196  
[   ]com.maxfour.music.json2022-11-22 16:18 198  
[   ]de.antonarnold.android.xoverrideheadphonejackdetection.json2022-11-21 08:07 198  
[   ]me.ranko.autodark.json2022-11-18 20:33 198  
[   ]uk.sensoryunderload.infinilist.json2022-11-25 09:52 198  
[   ]com.dosse.chromiumautoupdater.json2022-11-23 16:25 199  
[   ]com.github.axet.tonegenerator.json2022-11-23 08:47 199  
[   ]com.mareksebera.simpledilbert.json2022-11-22 16:49 199  
[   ]com.termux.window.json2022-11-21 22:27 199  
[   ]de.smasi.tickmate.json2022-11-20 19:37 199  
[   ]foundation.e.blisslauncher.json2022-11-20 07:11 199  
[   ]io.github.chiver.json2022-11-19 20:40 199  
[   ]net.mypapit.mobile.myposition.json2022-11-18 09:23 199  
[   ]org.ttrssreader.json2022-11-25 23:48 199  
[   ]protect.rentalcalc.json2022-11-25 16:54 199  
[   ]com.termux.nix.json2022-11-21 22:29 200  
[   ]org.hwyl.sexytopo.json2022-11-17 08:00 200  
[   ]ru.meefik.busybox.json2022-11-25 15:15 200  
[   ]com.gabm.screenrotationcontrol.json2022-11-23 11:18 201  
[   ]com.google.android.stardroid.json2022-11-23 04:59 201  
[   ]io.github.muntashirakon.setedit.json2022-11-19 17:41 201  
[   ]org.mattvchandler.a2050.json2022-11-17 01:38 201  
[   ]org.mosad.seil0.projectlaogai.json2022-11-17 00:06 201  
[   ]org.secuso.privacyfriendlydicer.json2022-11-16 07:16 201  
[   ]com.example.hochi.nextcompanion.json2022-11-23 13:21 202  
[   ]com.github.quarck.calnotify.json2022-11-23 06:20 202  
[   ]com.kunzisoft.keyboard.switcher.json2022-11-22 21:30 202  
[   ]de.jbservices.nc_passwords_app.json2022-11-21 01:35 202  
[   ]com.planes.android.json2022-11-22 06:49 203  
[   ]com.simplemobiletools.calendar.json2022-11-22 00:54 203  
[   ]com.termux.json2022-11-21 22:34 203  
[   ]es.ideotec.t16fling.json2022-11-20 11:31 203  
[   ]com.aaronhalbert.nosurfforreddit.json2022-11-24 09:54 204  
[   ]com.orgzly.json2022-11-22 08:42 204  
[   ]com.podverse.fdroid.json2022-11-22 06:34 204  
[   ]de.k3b.android.intentintercept.json2022-11-21 00:48 204  
[   ]de.k3b.android.lossless_jpg_crop.json2022-11-21 00:47 204  
[   ]org.secuso.privacyfriendlymemory.json2022-11-16 07:08 204  
[   ]com.farmerbb.secondscreen.free.json2022-11-23 12:52 205  
[   ]de.k3b.android.locationMapViewer.json2022-11-21 00:48 205  
[   ]it.feio.android.omninotes.foss.json2022-11-19 11:50 205  
[   ]luke.kfz.json2022-11-19 07:07 206  
[   ]org.connectbot.json2022-11-17 15:43 206  
[   ]org.fitchfamily.android.symphony.json2022-11-17 11:56 206  
[   ]org.mosad.teapod.json2022-11-17 00:04 206  
[   ]com.asdoi.timetable.json2022-11-24 06:51 207  
[   ]com.oF2pks.adbungfu.json2022-11-22 09:06 207  
[   ]io.github.domi04151309.powerapp.json2022-11-19 20:17 207  
[   ]io.github.froodyapp.json2022-11-19 19:49 207  
[   ]me.hackerchick.sharetoinputstick.json2022-11-18 21:06 207  
[   ]org.asnelt.derandom.json2022-11-17 18:11 207  
[   ]ca.rmen.android.frenchcalendar.json2022-11-24 12:52 208  
[   ]com.github.cvzi.darkmodewallpaper.json2022-11-23 08:12 208  
[   ]com.quinncasey.paperless_share.json2022-11-22 05:22 208  
[   ]com.rehanced.lunary.json2022-11-22 04:25 208  
[   ]de.moooon.acrylicons.json2022-11-20 21:47 208  
[   ]me.kuehle.carreport.json2022-11-18 20:53 208  
[   ]org.gittner.osmbugs.json2022-11-17 10:07 208  
[   ]troop.com.freedcam.json2022-11-25 11:13 208  
[   ]com.github.cetoolbox.json2022-11-23 08:13 209  
[   ]com.zeapo.pwdstore.json2022-11-21 15:03 209  
[   ]com.dozingcatsoftware.mouse_pounce.json2022-11-23 16:15 210  
[   ]com.github.siggel.coordinatejoker.json2022-11-23 05:50 210  
[   ]com.rubenwardy.minetestmodmanager.json2022-11-22 03:52 210  
[   ]de.koelle.christian.trickytripper.json2022-11-21 00:38 210  
[   ]me.murks.feedwatcher.json2022-11-18 20:43 210  
[   ]org.walleth.json2022-11-25 22:00 210  
[   ]com.celzero.bravedns.json2022-11-23 22:08 211  
[   ]com.github.muellerma.tabletoptools.json2022-11-23 06:55 211  
[   ]com.ichi2.anki.json2022-11-23 02:17 211  
[   ]de.fff.ccgt.json2022-11-21 02:33 211  
[   ]dev.msfjarvis.aps.json2022-11-20 14:40 211  
[   ]io.github.benoitduffez.cupsprint.json2022-11-19 20:45 211  
[   ]se.oandell.riksdagen.json2022-04-01 15:52 211  
[   ]com.picross.nonocross.json2022-11-22 07:18 212  
[   ]fr.cph.chicago.foss.json2022-02-05 16:37 212  
[   ]godau.fynn.dsbdirect.json2022-11-20 01:37 212  
[   ]nl.devluuk.sleepywifi.json2022-11-17 21:49 212  
[   ]com.fr3ts0n.androbd.plugin.mqtt.json2022-11-23 11:54 213  
[   ]de.markusfisch.android.pielauncher.json2022-11-20 23:07 213  
[   ]ru.henridellal.dialer.json2022-11-25 15:25 213  
[   ]com.jens.automation2.json2022-11-23 00:26 214  
[   ]de.kromke.andreas.opus1musicplayer.json2022-11-20 23:57 214  
[   ]at.jclehner.rxdroid.json2022-11-24 13:56 215  
[   ]com.danefinlay.ttsutil.json2022-11-23 18:17 215  
[   ]com.dimtion.shaarlier.json2022-11-23 17:04 215  
[   ]org.encointer.wallet.json2022-11-17 12:35 215  
[   ]rocks.tbog.tblauncher.json2022-11-25 16:45 215  
[   ]com.amaze.filemanager.json2022-11-24 09:02 216  
[   ]com.farmerbb.notepad.json2022-11-23 12:53 216  
[   ]com.ghstudios.android.mhgendatabase.json2022-11-23 10:19 216  
[   ]com.newsblur.json2022-11-22 13:35 216  
[   ]com.pcinpact.json2022-11-22 07:50 216  
[   ]de.baumann.pdfcreator.json2022-11-21 07:28 216  
[   ]de.kaffeemitkoffein.feinstaubwidget.json2022-11-21 00:41 216  
[   ]fr.corenting.convertisseureurofranc.json2022-11-20 06:48 216  
[   ]fr.guillaumevillena.opendnsupdater.json2022-11-20 04:22 216  
[   ]io.github.domi04151309.batterytool.json2022-11-19 20:18 216  
[   ]net.frju.flym.json2022-11-18 12:02 216  
[   ]net.nullsum.audinaut.json2022-11-18 09:18 216  
[   ]org.lumicall.android.json2022-11-17 02:23 216  
[   ]org.secuso.privacyfriendlynetmonitor.json2022-11-16 07:04 216  
[   ]xyz.myachin.downloader.json2022-11-25 09:01 216  
[   ]com.ds.avare.json2022-11-23 15:56 217  
[   ]com.hardcodecoder.pulsemusic.json2022-11-23 03:17 217  
[   ]com.menny.android.anysoftkeyboard.json2022-11-22 15:51 217  
[   ]com.perol.asdpl.play.pixivez.libre.json2022-11-22 07:37 217  
[   ]io.trezor.app.json2022-11-19 15:00 217  
[   ]at.bitfire.nophonespam.json2022-11-24 14:00 218  
[   ]com.nicobrailo.pianoli.json2022-11-22 11:54 218  
[   ]xyz.deepdaikon.xeonjia.json2022-11-25 09:16 218  
[   ]com.markuspage.android.atimetracker.json2022-11-22 16:47 219  
[   ]org.catrobat.paintroid.json2022-11-17 16:01 219  
[   ]org.midorinext.android.json2022-11-17 00:32 219  
[   ]org.secuso.privacyfriendlyfoodtracker.json2022-11-16 07:13 219  
[   ]app.fyreplace.client.json2022-11-24 15:20 220  
[   ]com.drhoffmannstoolsdataloggerreader.json2022-11-23 16:03 220  
[   ]info.metadude.android.divoc.schedule.json2022-11-19 21:59 220  
[   ]me.zeeroooo.materialfb.json2022-11-18 19:58 220  
[   ]org.mariotaku.twidere.json2022-11-17 01:51 220  
[   ]org.videolan.vlc.json2022-11-25 22:42 220  
[   ]tech.projectmatris.antimalwareapp.json2022-11-25 12:11 220  
[   ]foehnix.widget.json2022-11-20 07:18 221  
[   ]org.musicbrainz.picard.barcodescanner.json2022-11-16 21:27 221  
[   ]de.quaddyservices.dynamicnightlight.json2022-11-20 20:43 222  
[   ]host.stjin.anonaddy.json2022-11-20 00:54 222  
[   ]nl.mpcjanssen.simpletask.webdav.json2022-11-17 21:33 222  
[   ]org.droidtr.deletegapps.json2022-11-17 13:10 222  
[   ]org.dslul.openboard.inputmethod.latin.json2022-11-17 13:09 222  
[   ]au.id.micolous.farebot.json2022-11-24 13:33 223  
[   ]com.apozas.contactdiary.json2022-11-24 07:09 223  
[   ]com.indieweb.indigenous.json2022-11-23 02:09 223  
[   ]com.yacgroup.yacguide.json2022-11-21 15:17 223  
[   ]de.audioattack.openlink.json2022-11-21 08:03 223  
[   ]info.metadude.android.fosdem.schedule.json2022-11-19 21:54 223  
[   ]org.daylightingsociety.wherearetheeyes.json2022-11-17 14:43 223  
[   ]player.efis.data.sah.jap.json2022-11-25 19:26 223  
[   ]player.efis.data.usa.can.json2022-11-25 19:25 223  
[   ]player.efis.data.zar.aus.json2022-11-25 19:23 223  
[   ]app.fedilab.nitterizeme.json2022-11-24 15:26 224  
[   ]com.coinerella.peercoin.json2022-11-23 20:16 225  
[   ]com.movim.movim.json2022-11-22 14:28 225  
[   ]fi.kroon.vadret.json2022-11-20 07:27 225  
[   ]net.inbox.pager.json2022-11-18 11:20 225  
[   ]com.reminimalism.materialslivewallpaper.json2022-11-22 04:18 226  
[   ]com.tutpro.baresip.plus.json2022-11-21 20:08 226  
[   ]com.machiav3lli.backup.json2022-11-22 17:51 227  
[   ]eu.lepiller.nani.json2022-11-20 10:09 227  
[   ]us.spotco.malwarescanner.json2022-11-25 09:47 227  
[   ]com.bald.uriah.baldphone.json2022-11-24 04:12 228  
[   ]com.github.mueller_ma.viewandroidversion.json2022-11-23 06:55 228  
[   ]de.salomax.currencies.json2022-11-20 20:04 228  
[   ]de.storchp.opentracks.osmplugin.offline.json2022-11-20 19:12 228  
[   ]eu.roggstar.luigithehunter.dsaassistent.json2022-11-20 08:56 228  
[   ]org.kiwix.kiwixmobile.json2022-11-17 05:58 228  
[   ]ch.corten.aha.worldclock.json2022-11-24 11:50 229  
[   ]com.anysoftkeyboard.languagepack.spain.json2022-11-24 07:11 229  
[   ]com.genonbeta.TrebleShot.json2022-11-23 10:53 229  
[   ]io.github.subhamtyagi.ocr.json2022-11-19 17:31 229  
[   ]jp.redmine.redmineclient.json2022-11-19 08:51 229  
[   ]org.schabi.newpipelegacy.json2022-11-16 07:38 229  
[   ]com.crazylegend.vigilante.json2022-11-23 19:29 230  
[   ]ca.cmetcalfe.locationshare.json2022-11-24 13:05 231  
[   ]com.iven.iconify.json2022-11-23 01:04 231  
[   ]com.kabouzeid.gramophone.json2021-03-13 12:58 231  
[   ]com.moez.QKSMS.json2022-11-22 15:01 231  
[   ]com.plusonelabs.calendar.json2022-11-22 06:35 231  
[   ]com.rascarlo.arch.packages.json2022-11-22 04:53 231  
[   ]de.syss.MifareClassicTool.json2022-11-20 18:24 231  
[   ]nitezh.ministock.json2022-11-17 21:51 231  
[   ]org.andstatus.todoagenda.json2022-11-17 18:20 231  
[   ]org.epstudios.morbidmeter.json2022-11-17 12:33 231  
[   ]org.telegram.messenger.json2022-11-26 03:16 231  
[   ]org.zerodogg.migraineLog.json2022-11-25 19:52 231  
[   ]org.traffxml.roadeagle.json2022-11-26 00:11 232  
[   ]com.governikus.ausweisapp2.json2022-11-23 04:24 233  
[   ]org.secuso.privacyfriendlyactivitytracker.json2022-11-16 07:21 233  
[   ]tech.ula.json2022-11-25 12:01 234  
[   ]com.smartpack.smartflasher.json2022-11-21 23:46 235  
[   ]cz.vitskalicky.lepsirozvrh.json2022-11-21 08:11 235  
[   ]de.eidottermihi.raspicheck.json2022-11-21 03:08 235  
[   ]fr.odrevet.bide_et_musique.json2022-11-20 03:16 235  
[   ]net.mabako.steamgifts.json2022-11-18 10:49 235  
[   ]org.totschnig.ocr.tesseract.json2022-11-26 00:19 235  
[   ]tranquvis.simplesmsremote.json2022-11-25 11:22 235  
[   ]com.asdoi.gymwen.json2022-11-24 06:52 236  
[   ]com.kanedias.vanilla.lyrics.json2022-11-22 22:26 236  
[   ]com.simplemobiletools.draw.json2022-11-22 00:31 236  
[   ]de.beowulf.wetter.json2022-11-21 06:58 236  
[   ]de.tap.easy_xkcd.json2022-11-20 17:45 236  
[   ]eu.faircode.xlua.json2022-11-20 10:49 236  
[   ]org.woheller69.gpscockpit.json2022-11-25 21:28 236  
[   ]ua.gardenapple.itchupdater.json2022-11-25 11:05 236  
[   ]org.mbach.lemonde.json2022-11-17 01:36 237  
[   ]at.linuxtage.companion.json2022-11-24 13:55 238  
[   ]info.metadude.android.datenspuren.schedule.json2022-11-19 22:05 238  
[   ]app.fedilab.nitterizemelite.json2022-11-24 15:23 239  
[   ]com.github.vauvenal5.yaga.json2022-11-23 05:43 239  
[   ]com.todobom.opennotescanner.json2022-11-21 21:19 239  
[   ]de.chagemann.regexcrossword.json2022-11-21 05:26 239  
[   ]eu.uwot.fabio.altcoinprices.json2022-11-20 08:17 239  
[   ]fr.xgouchet.packageexplorer.json2022-11-20 02:22 239  
[   ]io.kuenzler.whatsappwebtogo.json2022-11-19 15:51 239  
[   ]ru.ra66it.updaterforspotify.json2022-11-25 15:00 239  
[   ]xyz.myachin.saveto.json2022-11-25 09:01 239  
[   ]com.craigd.lmsmaterial.app.json2022-11-23 19:38 240  
[   ]com.github.ashutoshgngwr.tenbitclockwidget.json2022-11-23 09:21 240  
[   ]com.simplemobiletools.notes.json2022-11-22 00:00 240  
[   ]org.deluge.trireme.json2022-11-17 14:27 240  
[   ]org.voidsink.anewjkuapp.json2022-11-25 22:19 240  
[   ]com.app.missednotificationsreminder.json2022-11-24 07:06 241  
[   ]com.kmac5dev.mindfulnotifier.json2022-11-22 22:03 241  
[   ]com.minar.randomix.json2022-11-22 15:42 241  
[   ]com.termux.styling.json2022-11-21 22:28 241  
[   ]fr.nuage.souvenirs.json2022-11-20 03:31 242  
[   ]org.kore.kolabnotes.android.json2022-11-17 05:33 242  
[   ]org.pacien.tincapp.json2022-11-16 15:57 242  
[   ]com.blockbasti.justanotherworkouttimer.json2022-11-24 00:15 243  
[   ]felixwiemuth.simplereminder.json2022-11-20 07:35 243  
[   ]me.hackerchick.raisetoanswer.json2022-11-18 21:06 243  
[   ]com.zorinos.zorin_connect.json2022-11-21 13:38 244  
[   ]community.peers.internetradio.json2022-11-22 14:13 244  
[   ]io.github.domi04151309.home.json2022-11-19 20:18 244  
[   ]net.mullvad.mullvadvpn.json2022-11-18 09:37 244  
[   ]org.emunix.insteadlauncher.json2022-11-17 12:37 244  
[   ]com.flxrs.dankchat.json2022-11-23 12:25 245  
[   ]de.tu_chemnitz.wlan.json2022-11-20 16:35 245  
[   ]org.jak_linux.dns66.json2022-11-17 07:01 245  
[   ]com.github.yeriomin.yalpstore.json2022-11-23 05:29 246  
[   ]com.jonjomckay.fritter.json2022-11-22 23:29 246  
[   ]com.krawieck.lemmur.json2022-11-22 21:42 246  
[   ]com.oF2pks.kalturadeviceinfos.json2022-11-22 08:59 246  
[   ]com.sapuseven.untis.json2022-11-22 02:45 246  
[   ]com.tutpro.baresip.json2022-11-21 20:31 246  
[   ]protect.budgetwatch.json2022-11-25 17:09 246  
[   ]com.dev.xavier.tempusromanum.json2022-11-23 17:20 247  
[   ]com.gh4a.json2022-11-23 10:24 247  
[   ]com.madlonkay.orgro.json2022-11-22 17:18 247  
[   ]com.manichord.mgit.json2022-11-22 17:08 247  
[   ]com.sunilpaulmathew.debloater.json2022-11-21 23:21 247  
[   ]eu.kanade.tachiyomi.json2022-11-20 10:21 247  
[   ]app.olauncher.json2022-11-24 15:06 249  
[   ]me.murks.filmchecker.json2022-11-18 20:38 249  
[   ]uk.org.ngo.squeezer.json2022-11-25 09:56 249  
[   ]agrigolo.chubbyclick.json2022-11-24 15:38 251  
[   ]com.github.ruleant.getback_gps.json2022-11-23 06:09 251  
[   ]com.maxistar.textpad.json2022-11-22 16:14 251  
[   ]com.sunilpaulmathew.translator.json2022-11-21 23:20 251  
[   ]com.ultramegatech.ey.json2022-11-21 19:12 251  
[   ]de.szalkowski.activitylauncher.json2022-11-20 18:23 251  
[   ]de.wellenvogel.bonjourbrowser.json2022-11-20 14:24 251  
[   ]design.codeux.authpass.fdroid.json2022-11-20 19:48 251  
[   ]me.impa.knockonports.json2022-11-18 21:03 251  
[   ]su.sadrobot.yashlang.json2022-11-25 12:44 251  
[   ]com.nextcloud_cookbook_flutter.json2022-11-22 13:20 252  
[   ]com.simplemobiletools.gallery.json2022-11-22 00:23 252  
[   ]de.k3b.android.androFotoFinder.json2022-11-21 00:50 252  
[   ]de.kromke.andreas.mediascanner.json2022-11-21 00:27 252  
[   ]hr.kravarscan.enchantedfortress.json2022-11-20 00:46 253  
[   ]de.storchp.opentracks.osmplugin.json2022-11-20 19:17 254  
[   ]org.secuso.privacyfriendlynotes.json2022-11-16 06:58 254  
[   ]xyz.deepdaikon.zoysii.json2022-11-25 09:10 254  
[   ]com.guillaumepayet.remotenumpad.json2022-11-23 04:12 255  
[   ]de.stephanlindauer.criticalmaps.json2022-11-20 19:20 255  
[   ]dev.corruptedark.openchaoschess.json2022-11-20 15:10 255  
[   ]es.esy.CosyDVR.json2022-11-20 11:31 255  
[   ]com.averi.worldscribe.json2022-11-24 06:30 256  
[   ]email.schaal.ocreader.json2022-11-20 11:34 256  
[   ]fr.jnda.android.flashalert.json2022-11-20 04:18 256  
[   ]site.leos.apps.lespas.json2022-11-25 13:20 256  
[   ]com.donnnno.arcticons.json2022-11-23 16:46 257  
[   ]de.tutao.tutanota.json2022-11-20 15:17 257  
[   ]me.hackerchick.catima.json2022-11-18 21:07 257  
[   ]net.minetest.minetest.json2022-11-18 10:04 257  
[   ]org.tengel.planisphere.json2022-11-26 02:05 257  
[   ]tool.fff.profilepicturegenerator.json2022-11-25 11:36 258  
[   ]com.poupa.attestationdeplacement.json2022-11-22 06:21 259  
[   ]io.github.domi04151309.alwayson.json2022-11-19 20:18 259  
[   ]io.vertretungsplan.client.android.json2022-11-19 14:51 259  
[   ]com.dkanada.gramophone.json2022-11-23 16:57 260  
[   ]mobi.omegacentauri.SendReduced.json2022-11-18 18:49 260  
[   ]com.gsnathan.pdfviewer.json2022-11-23 04:14 261  
[   ]com.infomaniak.sync.json2022-11-23 01:43 261  
[   ]com.mendhak.gpslogger.json2022-11-22 15:59 261  
[   ]com.rtbishop.look4sat.json2022-11-22 03:55 261  
[   ]com.wangdaye.mysplash.json2021-03-08 22:50 261  
[   ]com.wireguard.android.json2022-11-21 16:04 261  
[   ]cz.dvratil.fbeventsync.json2022-11-21 08:34 261  
[   ]eu.quelltext.mundraub.json2022-11-20 08:57 261  
[   ]player.efis.cfd.json2022-11-25 19:42 261  
[   ]rocks.poopjournal.morse.json2022-11-25 16:47 261  
[   ]threads.server.json2022-11-25 11:52 261  
[   ]com.benny.openlauncher.json2022-11-24 02:00 262  
[   ]com.chessclock.android.json2022-11-23 20:43 262  
[   ]joshuatee.wx.json2022-11-19 09:24 262  
[   ]org.fox.tttrss.json2022-11-17 11:26 262  
[   ]com.jkuester.unlauncher.json2022-11-23 00:09 263  
[   ]org.secuso.privacyfriendlytodolist.json2022-11-16 06:24 263  
[   ]ca.chancehorizon.paseo.json2022-11-24 13:06 264  
[   ]com.antony.muzei.pixiv.json2022-11-24 07:18 266  
[   ]com.greenaddress.abcore.json2022-11-23 04:15 266  
[   ]com.redcoracle.episodes.json2022-11-22 04:40 266  
[   ]com.serwylo.babydots.json2022-11-22 01:33 266  
[   ]player.efis.data.eur.rus.json2022-11-25 19:33 266  
[   ]click.dummer.textthing.json2022-11-24 10:26 267  
[   ]eu.sum7.conversations.json2022-11-20 08:26 267  
[   ]name.gdr.acastus_photon.json2022-11-18 17:55 267  
[   ]org.runnerup.free.json2022-11-16 13:05 267  
[   ]ru.yanus171.feedexfork.json2022-11-25 14:47 267  
[   ]com.tachibana.downloader.json2022-11-21 23:07 268  
[   ]me.kavishhukmani.watwitchstickers.json2022-11-18 20:57 268  
[   ]moe.dic1911.urlsanitizer.json2022-11-18 18:48 269  
[   ]org.ligi.survivalmanual.json2022-11-17 04:30 269  
[   ]co.timsmart.vouchervault.json2022-11-21 13:33 271  
[   ]com.faltenreich.diaguard.json2022-11-23 12:56 271  
[   ]com.jarsilio.android.autoautorotate.json2022-11-23 00:53 271  
[   ]com.oriondev.moneywallet.json2022-11-22 08:37 271  
[   ]io.github.subhamtyagi.openinwhatsapp.json2022-11-19 17:11 271  
[   ]net.fabiszewski.ulogger.json2022-11-18 12:03 271  
[   ]net.redwarp.gifwallpaper.json2022-11-18 01:13 271  
[   ]org.fitchfamily.android.gsmlocation.json2022-11-17 11:56 271  
[   ]org.nonononoki.hendroid.json2022-11-16 20:36 271  
[   ]org.billthefarmer.notes.json2022-11-17 16:42 272  
[   ]com.dosse.airpods.json2022-11-23 16:28 273  
[   ]itkach.aard2.json2022-11-19 11:40 275  
[   ]net.nurik.roman.muzei.json2022-11-18 09:14 275  
[   ]be.ppareit.swiftp_free.json2022-11-24 13:17 276  
[   ]com.github.cythara.json2022-11-23 08:10 278  
[   ]ml.docilealligator.infinityforreddit.json2022-11-18 19:36 278  
[   ]net.gaast.giggity.json2022-11-18 12:01 278  
[   ]com.gianlu.dnshero.json2022-11-23 10:14 279  
[   ]com.github.fi3te.notificationcron.json2022-11-23 07:34 280  
[   ]de.blinkt.openvpn.json2022-11-21 05:45 280  
[   ]org.gnu.icecat.json2022-11-17 08:53 280  
[   ]eu.faircode.email.json2022-11-20 11:09 281  
[   ]fr.gouv.android.stopcovid.json2022-11-20 05:04 281  
[   ]org.yuttadhammo.BodhiTimer.json2022-11-25 20:28 281  
[   ]com.github.muellerma.coffee.json2022-11-23 07:01 285  
[   ]com.oF2pks.applicationsinfo.json2022-11-22 09:06 285  
[   ]com.perflyst.twire.json2022-11-22 07:44 285  
[   ]me.tsukanov.counter.json2022-11-18 20:07 285  
[   ]ryey.easer.beta.json2022-11-25 14:39 285  
[   ]com.github.axet.bookreader.json2022-11-23 09:09 286  
[   ]com.llamacorp.equate.json2022-11-22 18:46 286  
[   ]ee.ioc.phon.android.speak.json2022-11-20 11:47 286  
[   ]de.rwth_aachen.phyphox.json2022-11-20 20:21 287  
[   ]org.decsync.cc.json2022-11-17 14:31 287  
[   ]com.kunzisoft.keepass.libre.json2022-11-22 21:41 288  
[   ]com.serwylo.beatgame.json2022-11-22 01:30 288  
[   ]com.unciv.app.json2022-11-21 18:35 289  
[   ]org.gdroid.gdroid.json2022-11-17 10:22 290  
[   ]com.apps.adrcotfas.goodtime.json2022-11-24 06:58 291  
[   ]com.darshancomputing.BatteryIndicator.json2022-11-23 17:59 291  
[   ]com.dozingcatsoftware.bouncy.json2022-11-23 16:17 291  
[   ]com.jarsilio.android.drowser.json2022-11-23 00:50 291  
[   ]com.smartpack.packagemanager.json2022-11-21 23:47 291  
[   ]de.baumann.hhsmoodle.json2022-11-21 07:35 291  
[   ]de.uni_potsdam.hpi.openmensa.json2022-11-20 15:13 291  
[   ]exa.lnx.a.json2022-11-20 07:49 291  
[   ]io.github.lonamiwebs.klooni.json2022-11-19 18:58 291  
[   ]name.boyle.chris.sgtpuzzles.json2022-11-18 17:59 291  
[   ]openfoodfacts.github.scrachx.openbeauty.json2022-11-17 20:18 291  
[   ]org.ostrya.presencepublisher.json2022-11-16 16:18 291  
[   ]com.android.keepass.json2022-11-24 08:39 292  
[   ]com.samebits.beacon.locator.json2022-11-22 02:53 292  
[   ]org.projectmaxs.main.json2022-11-16 14:58 292  
[   ]org.transdroid.full.json2022-11-26 00:00 292  
[   ]uk.co.busydoingnothing.prevo.json2022-11-25 10:12 292  
[   ]com.biglybt.android.client.json2021-03-13 11:20 296  
[   ]com.kanedias.vanilla.audiotag.json2022-11-22 22:28 296  
[   ]com.pierreduchemin.smsforward.json2022-11-22 07:16 296  
[   ]de.jl.notificationlog.json2022-11-21 01:05 296  
[   ]org.openpetfoodfacts.scanner.json2022-11-16 16:46 296  
[   ]com.easyfitness.json2022-11-23 15:38 297  
[   ]com.fabienli.dokuwiki.json2022-11-23 12:58 297  
[   ]de.chaosdorf.meteroid.json2022-11-21 05:21 297  
[   ]de.jkliemann.parkendd.json2022-11-21 01:06 297  
[   ]it.rignanese.leo.slimfacebook.json2022-02-05 00:21 297  
[   ]org.ligi.passandroid.json2022-11-17 04:43 297  
[   ]net.sourceforge.solitaire_cg.json2022-11-17 23:14 298  
[   ]org.nuntius35.wrongpinshutdown.json2022-11-16 20:33 299  
[   ]org.secuso.privacyfriendlypasswordgenerator.json2022-11-16 06:40 299  
[   ]org.sw24softwares.starkeverben.json2022-11-26 03:46 299  
[   ]com.ktprograms.ohmsnow.json2022-11-22 21:41 300  
[   ]nl.yoerinijs.notebuddy.json2022-11-17 21:31 300  
[   ]com.github.axet.binauralbeats.json2022-11-23 09:11 301  
[   ]com.github.axet.mover.json2022-11-23 08:53 301  
[   ]com.oasisfeng.island.fdroid.json2022-11-22 09:26 301  
[   ]de.hauke_stieler.geonotes.json2022-11-21 01:55 301  
[   ]de.nulide.findmydevice.json2022-11-20 21:36 301  
[   ]org.softeg.slartus.forpdaplus.json2022-03-18 07:54 301  
[   ]de.freewarepoint.whohasmystuff.json2022-11-21 02:19 302  
[   ]io.simplelogin.android.fdroid.json2022-11-19 15:12 302  
[   ]com.parishod.watomatic.json2022-11-22 07:54 303  
[   ]com.zell_mbc.medilog.json2022-11-21 14:56 303  
[   ]org.mozilla.klar.json2022-11-25 08:30 303  
[   ]com.kanedias.vanilla.coverfetch.json2022-11-22 22:27 304  
[   ]com.mkulesh.onpc.json2022-11-22 15:22 304  
[   ]com.termoneplus.json2022-11-21 22:39 304  
[   ]org.disroot.disrootapp.json2022-11-17 13:27 304  
[   ]privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.json2022-11-25 17:27 307  
[   ]org.secuso.privacyfriendlysudoku.json2022-11-16 06:32 308  
[   ]com.github.postapczuk.lalauncher.json2022-11-23 06:46 309  
[   ]de.markusfisch.android.wavelines.json2022-11-20 23:03 309  
[   ]org.dmfs.tasks.json2022-11-17 13:18 309  
[   ]com.gpl.rpg.AndorsTrail.json2022-11-23 04:21 310  
[   ]io.mainframe.hacs.json2022-11-19 15:48 310  
[   ]libvirt-debian-bullseye-vagrant-amd64-official-20221010-1.box.sig2022-10-10 11:56 310  
[   ]net.eneiluj.moneybuster.json2022-11-18 12:24 310  
[   ]net.eneiluj.nextcloud.phonetrack.json2022-11-18 12:17 310  
[   ]net.kourlas.voipms_sms.json2022-11-18 11:00 310  
[   ]virtualbox-debian-bullseye-vagrant-amd64-official-20221010-1.box.sig2022-10-10 11:59 310  
[   ]de.nulide.shiftcal.json2022-11-20 21:35 313  
[   ]de.spiritcroc.darkcroc.substratum.json2022-11-20 19:37 313  
[   ]kiwi.root.an2linuxclient.json2022-11-19 08:33 313  
[   ]be.digitalia.fosdem.json2022-11-24 13:24 314  
[   ]com.marv42.ebt.newnote.json2022-11-22 16:45 314  
[   ]com.kolloware.hypezigapp.json2022-11-22 21:55 315  
[   ]fr.corenting.traficparis.json2022-11-20 06:48 315  
[   ]org.decsync.sparss.floss.json2022-11-17 14:28 315  
[   ]org.xbmc.kore.json2022-11-25 21:03 315  
[   ]io.timelimit.android.aosp.direct.json2022-11-19 15:10 316  
[   ]org.y20k.trackbook.json2022-11-25 20:35 316  
[   ]superfreeze.tool.android.json2022-11-25 12:59 316  
[   ]org.y20k.escapepod.json2022-11-25 20:36 317  
[   ]dev.lucanlm.antimine.json2022-11-20 14:53 318  
[   ]com.odnovolov.forgetmenot.json2022-11-22 09:16 320  
[   ]io.github.subhamtyagi.lastlauncher.json2022-11-19 17:32 320  
[   ]com.bytehamster.changelog.json2022-11-23 22:28 321  
[   ]org.projectmaxs.module.nfc.json2022-11-16 14:50 322  
[   ]com.termux.api.json2022-11-21 22:31 323  
[   ]de.msal.muzei.nationalgeographic.json2022-11-20 21:46 323  
[   ]at.bitfire.icsdroid.json2022-11-24 14:00 324  
[   ]com.mikifus.padland.json2022-11-22 15:46 324  
[   ]org.eu.exodus_privacy.exodusprivacy.json2022-11-17 12:29 324  
[   ]im.quicksy.client.json2022-11-20 00:33 325  
[   ]fr.ralala.hexviewer.json2022-11-20 03:07 326  
[   ]dummydomain.yetanothercallblocker.json2022-11-20 12:20 327  
[   ]io.github.sds100.keymapper.json2022-11-19 17:36 327  
[   ]org.freenetproject.mobile.json2022-11-17 10:50 327  
[   ]org.projectmaxs.module.misc.json2022-11-16 14:51 327  
[   ]ru.playsoftware.j2meloader.json2022-11-25 15:02 327  
[   ]fr.free.nrw.commons.json2022-02-05 15:30 329  
[   ]org.isoron.uhabits.json2022-11-17 07:20 329  
[   ]org.paladyn.mediclog.json2022-11-16 15:53 330  
[   ]de.moekadu.metronome.json2022-11-20 22:36 331  
[   ]org.droidtr.keyboard.json2022-11-17 13:10 331  
[   ]ch.rmy.android.statusbar_tacho.json2022-11-24 10:53 332  
[   ]com.samco.trackandgraph.json2022-11-22 03:00 332  
[   ]net.sourceforge.kid3.json2022-11-18 00:08 332  
[   ]org.gateshipone.malp.json2022-11-17 10:34 332  
[   ]org.projectmaxs.module.shell.json2022-11-16 14:47 332  
[   ]com.poupa.vinylmusicplayer.json2022-11-22 05:56 334  
[   ]fr.ubordeaux.math.paridroid.json2022-11-20 02:40 334  
[   ]ch.rmy.android.http_shortcuts.json2022-11-24 10:57 337  
[   ]com.rascarlo.aurdroid.json2022-11-22 04:47 337  
[   ]de.schildbach.oeffi.json2022-11-20 20:00 337  
[   ]com.simplemobiletools.dialer.json2022-11-22 00:33 338  
[   ]eu.pretix.pretixprint.json2022-11-20 09:43 338  
[   ]com.aurora.store.json2022-11-24 06:45 339  
[   ]com.farmerbb.taskbar.json2022-11-23 12:45 339  
[   ]de.storchp.fdroidbuildstatus.json2022-11-20 19:19 339  
[   ]eu.faircode.netguard.json2022-11-20 10:50 339  
[   ]ws.xsoh.etar.json2022-11-25 09:30 340  
[   ]openfoodfacts.github.scrachx.openfood.json2022-11-17 19:44 341  
[   ]me.echeung.moemoekyun.fdroid.json2022-11-18 21:13 342  
[   ]org.projectmaxs.module.smsread.json2022-11-16 14:45 342  
[   ]org.projectmaxs.module.smssend.json2022-11-16 14:45 342  
[   ]org.projectmaxs.transport.xmpp.json2022-11-16 14:35 342  
[   ]de.kaffeemitkoffein.imagepipe.json2022-11-21 00:41 345  
[   ]de.luhmer.owncloudnewsreader.json2022-11-20 23:09 345  
[   ]org.blokada.alarm.json2022-11-17 16:20 345  
[   ]org.projectmaxs.module.alarmset.json2022-11-16 14:58 347  
[   ]org.projectmaxs.module.fileread.json2022-11-16 14:54 347  
[   ]org.projectmaxs.module.smswrite.json2022-11-16 14:44 347  
[   ]pc.javier.seguime.json2022-11-25 19:43 347  
[   ]com.android.gpstest.osmdroid.json2022-11-24 08:47 348  
[   ]app.reading.stoic.stoicreading.json2022-11-24 15:02 351  
[   ]com.adguard.android.contentblocker.json2022-11-24 09:32 351  
[   ]com.github.cvzi.screenshottile.json2022-11-23 08:11 351  
[   ]com.simplemobiletools.draw.pro.json2022-11-22 00:29 351  
[   ]com.stypox.mastercom_workbook.json2022-11-21 23:21 351  
[   ]com.oF2pks.jquarks.json2022-11-22 09:03 352  
[   ]org.projectmaxs.module.bluetooth.json2022-11-16 14:57 352  
[   ]org.projectmaxs.module.clipboard.json2022-11-16 14:55 352  
[   ]org.projectmaxs.module.filewrite.json2022-11-16 14:53 352  
[   ]org.projectmaxs.module.smsnotify.json2022-11-16 14:46 352  
[   ]com.ulicae.cinelog.json2022-11-21 19:13 355  
[   ]org.traccar.client.json2022-11-26 00:14 355  
[   ]cityfreqs.com.pilfershushjammer.json2022-11-24 10:34 357  
[   ]de.j4velin.wifiAutoOff.json2022-11-21 01:42 357  
[   ]org.projectmaxs.module.ringermode.json2022-11-16 14:48 357  
[   ]org.projectmaxs.module.wifiaccess.json2022-11-16 14:43 357  
[   ]org.projectmaxs.module.wifichange.json2022-11-16 14:42 357  
[   ]com.duckduckgo.mobile.android.json2022-11-23 15:51 358  
[   ]com.fsck.k9.json2022-11-23 11:23 358  
[   ]net.programmierecke.radiodroid2.json2022-11-18 01:18 358  
[   ]com.ubergeek42.WeechatAndroid.json2022-11-21 19:33 359  
[   ]net.schueller.peertube.json2022-11-18 00:42 359  
[   ]org.eehouse.android.xw4.json2022-11-17 12:47 360  
[   ]org.smssecure.smssecure.json2022-11-25 06:35 360  
[   ]de.tadris.fitness.json2022-11-20 18:03 361  
[   ]im.vector.alpha.json2022-11-20 00:20 361  
[   ]org.twistedappdeveloper.statocovid19italia.json2022-11-25 23:24 361  
[   ]com.simplemobiletools.calculator.json2022-11-22 00:54 363  
[   ]com.kylecorry.trail_sense.json2022-11-22 21:18 365  
[   ]com.gitlab.ardash.appleflinger.android.json2022-11-23 05:27 366  
[   ]com.tmendes.birthdaydroid.json2022-11-21 22:05 366  
[   ]info.dvkr.screenstream.json2022-11-19 22:33 366  
[   ]io.github.wulkanowy.json2022-11-19 17:02 366  
[   ]vocabletrainer.heinecke.aron.vocabletrainer.json2022-11-25 09:43 366  
[   ]de.danoeh.antennapod.json2022-11-21 04:27 367  
[   ]io.github.lonamiwebs.stringlate.json2022-11-19 18:51 367  
[   ]org.billthefarmer.shorty.json2022-11-17 16:38 367  
[   ]org.projectmaxs.module.contactsread.json2022-11-16 14:54 367  
[   ]org.projectmaxs.module.locationfine.json2022-11-16 14:52 367  
[   ]org.projectmaxs.module.notification.json2022-11-16 14:49 367  
[   ]org.wikipedia.json2022-11-25 21:29 367  
[   ]com.simplemobiletools.applauncher.json2022-11-22 00:56 368  
[   ]de.grobox.liberario.json2021-03-13 16:06 368  
[   ]io.homeassistant.companion.android.minimal.json2022-11-19 16:18 369  
[   ]com.coboltforge.dontmind.multivnc.json2022-11-23 20:25 370  
[   ]ch.logixisland.anuto.json2022-11-24 11:41 371  
[   ]pw.thedrhax.mosmetro.json2022-11-25 16:53 371  
[   ]ch.bailu.aat.json2022-11-24 12:04 372  
[   ]com.simplemobiletools.smsmessenger.json2022-11-21 23:56 373  
[   ]com.tengu.sharetoclipboard.json2022-11-21 22:40 373  
[   ]fr.chenry.android.freshrss.json2022-11-20 06:48 373  
[   ]com.example.forgottenumbrella.cardboardmuseum.json2022-11-23 13:25 374  
[   ]de.dennisguse.opentracks.json2022-11-21 04:02 374  
[   ]net.sourceforge.opencamera.json2022-11-17 23:29 374  
[   ]org.mian.gitnex.json2022-11-17 01:03 374  
[   ]com.physphil.android.unitconverterultimate.json2022-11-22 07:18 376  
[   ]de.blau.android.json2022-11-21 06:38 377  
[   ]org.projectmaxs.module.bluetoothadmin.json2022-11-16 14:56 377  
[   ]org.projectmaxs.module.phonestateread.json2022-11-16 14:49 377  
[   ]com.jmstudios.redmoon.json2022-11-22 23:29 379  
[   ]com.utazukin.ichaival.json2022-11-21 18:07 379  
[   ]com.vrem.wifianalyzer.json2022-11-21 16:56 379  
[   ]net.ktnx.mobileledger.json2022-11-18 10:54 379  
[   ]org.openhab.habdroid.json2022-11-16 19:32 379  
[   ]com.simplemobiletools.clock.json2022-11-22 00:44 380  
[   ]com.simplemobiletools.voicerecorder.json2022-11-21 23:55 380  
[   ]com.mkulesh.micromath.plus.json2022-11-22 15:27 381  
[   ]de.geeksfactory.opacclient.json2022-11-21 02:06 381  
[   ]net.bible.android.activity.json2022-11-18 12:39 381  
[   ]org.billthefarmer.melodeon.json2022-11-17 16:44 381  
[   ]com.github.gotify.json2022-11-23 07:25 382  
[   ]com.spisoft.quicknote.json2022-11-21 23:37 386  
[   ]de.k3b.android.toGoZip.json2022-11-21 00:45 386  
[   ]com.gelakinetic.mtgfam.json2022-11-23 10:53 387  
[   ]com.jarsilio.android.scrambledeggsif.json2022-11-23 00:48 387  
[   ]me.ccrama.redditslide.json2022-11-18 21:19 387  
[   ]org.blitzortung.android.app.json2022-11-17 16:25 387  
[   ]org.epstudios.epmobile.json2022-11-17 12:34 387  
[   ]org.zephyrsoft.trackworktime.json2022-11-25 20:04 388  
[   ]ru.henridellal.emerald.json2022-11-25 15:24 388  
[   ]org.nitri.opentopo.json2022-11-16 21:04 392  
[   ]fr.gaulupeau.apps.InThePoche.json2022-11-20 05:18 393  
[   ]io.github.deweyreed.clipboardcleaner.json2022-11-19 20:20 393  
[   ]com.ctemplar.app.fdroid.json2022-11-23 19:07 394  
[   ]de.kromke.andreas.musictagger.json2022-11-21 00:08 394  
[   ]org.openobservatory.ooniprobe.json2022-11-16 17:02 394  
[   ]com.iven.musicplayergo.json2022-11-23 00:59 395  
[   ]org.gateshipone.odyssey.json2022-11-17 10:25 395  
[   ]org.happypeng.sumatora.android.sumatoradictionary.json2022-11-17 08:33 396  
[   ]de.baumann.browser.json2022-11-21 07:46 398  
[   ]fr.neamar.kiss.json2022-11-20 03:50 399  
[   ]uk.org.boddie.android.weatherforecast.json2022-11-25 09:57 400  
[   ]com.fr3ts0n.ecu.gui.androbd.json2022-11-23 11:53 401  
[   ]com.simplemobiletools.thankyou.json2022-11-21 23:55 401  
[   ]hu.vmiklos.plees_tracker.json2022-11-20 00:45 401  
[   ]com.github.axet.torrentclient.json2022-11-23 08:44 402  
[   ]com.junjunguo.pocketmaps.json2022-11-22 22:56 402  
[   ]de.t_dankworth.secscanqr.json2022-11-20 17:35 402  
[   ]org.y20k.transistor.json2022-11-25 20:31 402  
[   ]protect.card_locker.json2022-11-25 17:02 402  
[   ]org.commonvoice.saverio.json2022-11-17 15:45 403  
[   ]com.github.axet.smsgate.json2022-11-23 08:50 404  
[   ]apps.amine.bou.readerforselfoss.json2022-11-24 14:56 405  
[   ]de.marmaro.krt.ffupdater.json2022-11-20 23:00 405  
[   ]de.bahnhoefe.deutschlands.bahnhofsfotos.json2022-11-21 07:54 406  
[   ]info.metadude.android.congress.schedule.json2022-11-19 22:12 406  
[   ]com.numguesser.tonio_rpchp.numberguesser.json2022-11-22 10:32 408  
[   ]com.yacgroup.yacguide.dev.json2022-11-21 15:17 408  
[   ]net.gsantner.markor.json2022-11-18 11:35 410  
[   ]com.beemdevelopment.aegis.json2022-11-24 02:22 411  
[   ]fr.nocle.passegares.json2022-11-20 03:43 411  
[   ]com.health.openscale.json2022-11-23 02:51 412  
[   ]com.quaap.launchtime.json2022-11-22 05:27 412  
[   ]de.pixart.messenger.json2022-11-20 21:02 412  
[   ]org.totschnig.myexpenses.json2022-11-26 00:29 412  
[   ]org.moire.ultrasonic.json2022-11-17 00:24 413  
[   ]com.workingagenda.democracydroid.json2022-11-21 15:53 415  
[   ]io.timelimit.android.open.json2022-11-19 15:09 415  
[   ]com.pitchedapps.frost.json2022-11-22 06:51 419  
[   ]com.wmstein.transektcount.json2022-11-21 15:57 419  
[   ]org.moire.opensudoku.json2022-11-17 00:25 419  
[   ]wseemann.media.romote.json2022-11-25 09:40 419  
[   ]org.secuso.privacyfriendlyweather.json2022-11-16 06:19 420  
[   ]org.briarproject.briar.android.json2022-11-25 06:25 422  
[   ]com.forrestguice.suntimescalendars.json2022-11-23 12:19 426  
[   ]org.shadowice.flocke.andotp.json2022-11-16 05:37 426  
[   ]ar.rulosoft.mimanganu.json2022-11-24 14:51 427  
[   ]opencontacts.open.com.opencontacts.json2022-11-17 20:28 427  
[   ]com.igisw.openmoneybox.json2022-11-23 02:15 429  
[   ]com.wmstein.tourcount.json2022-11-21 16:00 429  
[   ]org.woheller69.weather.json2022-11-25 21:18 429  
[   ]com.tobykurien.webapps.json2022-11-21 21:35 430  
[   ]de.baumann.weather.json2022-11-21 07:03 431  
[   ]org.andstatus.app.json2022-11-17 18:20 431  
[   ]com.cookiegames.smartcookie.json2022-11-23 19:43 432  
[   ]com.nextcloud.talk2.json2022-11-22 12:23 434  
[   ]com.vincent_falzon.discreetlauncher.json2022-11-21 17:26 434  
[   ]com.byagowi.persiancalendar.json2022-11-23 22:31 435  
[   ]com.github.axet.filemanager.json2022-11-23 08:58 435  
[   ]com.simplemobiletools.camera.json2022-11-22 00:45 435  
[   ]dk.kjeldsen.carwingsflutter.json2022-11-20 12:44 435  
[   ]org.primftpd.json2022-11-16 15:01 435  
[   ]com.keylesspalace.tusky.json2022-11-22 22:10 436  
[   ]de.christinecoenen.code.zapp.json2022-11-21 05:15 436  
[   ]org.billthefarmer.accordion.json2022-11-17 17:04 436  
[   ]org.billthefarmer.crossword.json2022-11-17 17:02 436  
[   ]org.hlwd.bible_multi_the_life.json2022-11-17 08:07 436  
[   ]de.reimardoeffinger.quickdic.json2022-11-20 20:38 440  
[   ]free.rm.skytube.oss.json2022-11-20 05:57 440  
[   ]com.dkanada.icecons.json2022-11-23 16:51 441  
[   ]com.b44t.messenger.json2022-11-24 04:35 442  
[   ]org.nutritionfacts.dailydozen.json2022-11-16 20:28 444  
[   ]de.kaffeemitkoffein.tinyweatherforecastgermany.json2022-11-21 00:41 447  
[   ]fr.gouv.etalab.mastodon.json2022-11-20 04:49 448  
[   ]org.billthefarmer.scope.json2022-11-17 16:40 448  
[   ]com.example.trigger.json2022-11-23 13:01 451  
[   ]link.standen.michael.slideshow.json2022-11-19 07:10 451  
[   ]com.github.ashutoshgngwr.noice.json2022-11-23 09:23 452  
[   ]org.hlwd.bible.json2022-11-17 08:18 452  
[   ]com.simplemobiletools.filemanager.pro.json2022-11-22 00:29 454  
[   ]com.serwylo.lexica.json2022-11-22 01:25 456  
[   ]org.billthefarmer.siggen.json2022-11-17 16:36 457  
[   ]org.proninyaroslav.libretorrent.json2022-11-16 14:28 457  
[   ]org.xphnx.ameixa.json2022-11-25 20:50 457  
[   ]info.zamojski.soft.towercollector.json2022-11-19 21:08 458  
[   ]com.prangesoftwaresolutions.audioanchor.json2022-11-22 05:47 464  
[   ]org.openhab.habdroid.beta.json2022-11-16 18:36 465  
[   ]cat.mvmike.minimalcalendarwidget.json2022-11-24 12:36 467  
[   ]com.simplemobiletools.flashlight.json2022-11-22 00:26 467  
[   ]de.arnowelzel.android.periodical.json2022-11-21 08:04 467  
[   ]de.markusfisch.android.binaryeye.json2022-11-20 23:07 467  
[   ]com.DartChecker.json2022-11-23 17:55 469  
[   ]ca.rmen.android.poetassistant.json2022-11-24 12:48 473  
[   ]org.thosp.yourlocalweather.json2022-11-26 01:49 474  
[   ]ryey.easer.json2022-11-25 14:44 475  
[   ]at.bitfire.davdroid.json2022-11-24 14:13 476  
[   ]org.schabi.newpipe.json2022-11-16 07:38 477  
[   ]org.tlhInganHol.android.klingonassistant.json2022-11-26 01:32 478  
[   ]com.simplemobiletools.contacts.pro.json2022-11-22 00:33 483  
[   ]org.sufficientlysecure.keychain.json2022-11-26 04:03 484  
[   ]org.kde.kdeconnect_tp.json2022-11-17 06:29 489  
[   ]sh.ftp.rocketninelabs.meditationassistant.opensource.json2022-11-25 13:53 489  
[   ]com.github.axet.callrecorder.json2022-11-23 09:04 492  
[   ]org.billthefarmer.tuner.json2022-11-17 16:31 492  
[   ]com.github.catfriend1.syncthingandroid.json2022-11-23 08:18 493  
[   ]io.github.gsantner.memetastic.json2022-11-19 19:07 493  
[   ]org.mozilla.fennec_fdroid.json2022-11-16 22:01 493  
[   ]org.fdroid.fdroid.privileged.json2022-11-25 06:32 501  
[   ]rkr.simplekeyboard.inputmethod.json2022-11-25 16:48 501  
[   ]player.efis.mfd.json2022-11-25 19:21 503  
[   ]de.westnordost.streetcomplete.json2022-11-20 13:42 505  
[   ]com.secuso.privacyFriendlyCodeScanner.json2022-11-22 01:38 506  
[   ]com.brentpanther.bitcoinwidget.json2022-11-23 23:01 510  
[   ]com.simplemobiletools.notes.pro.json2022-11-21 23:56 510  
[   ]me.blog.korn123.easydiary.json2022-11-18 21:57 511  
[   ]cz.martykan.forecastie.json2022-11-21 08:12 513  
[   ]com.ghostsq.commander.json2022-11-23 10:21 514  
[   ]org.asteroidos.sync.json2022-11-17 18:07 514  
[   ]xyz.hisname.fireflyiii.json2022-11-25 09:10 514  
[   ]it.reyboz.bustorino.json2022-11-19 09:58 519  
[   ]org.quantumbadger.redreader.json2022-11-16 13:27 522  
[   ]io.github.fvasco.pinpoi.json2022-11-19 19:26 524  
[   ]de.markusfisch.android.shadereditor.json2022-11-20 23:04 546  
[   ]com.seafile.seadroid2.json2022-11-22 02:16 551  
[   ]com.orgzly_78.apk.json2021-03-09 08:16 559  
[   ]com.github.axet.hourlyreminder.json2022-11-23 08:54 562  
[   ]com.orgzly_152.apk.json2021-03-09 08:16 563  
[   ]com.zoffcc.applications.trifa.json2022-11-21 13:57 571  
[   ]com.oF2pks.classyshark3xodus.json2022-11-22 09:04 576  
[   ]nl.mpcjanssen.simpletask.json2022-11-17 21:45 577  
[   ]com.fsck.k9_27003.apk.json2021-03-10 00:16 578  
[   ]com.corona_info_12.apk.json2021-03-10 05:55 582  
[   ]app.fedilab.lite_319.apk.json2021-02-27 15:49 593  
[   ]com.nononsenseapps.feeder.json2022-11-22 11:33 593  
[   ]app.fedilab.lite_380.apk.json2021-03-13 09:53 594  
[   ]com.oF2pks.netscope_6.apk.json2021-03-09 08:40 598  
[   ]dnsfilter.android.json2022-11-20 12:39 598  
[   ]com.oF2pks.netscope_4.apk.json2021-03-09 08:40 599  
[   ]com.podverse.fdroid_3.apk.json2021-03-13 14:17 599  
[   ]com.simplemobiletools.calendar.pro.json2022-11-22 00:48 601  
[   ]app.fedilab.tubelab_33.apk.json2021-03-13 10:00 604  
[   ]com.x1unix.s60icons_110.apk.json2021-03-08 21:52 608  
[   ]be.mygod.vpnhotspot_217.apk.json2021-02-27 14:31 609  
[   ]de.grobox.liberario_115.apk.json2021-03-08 15:35 609  
[   ]de.grobox.liberario_117.apk.json2021-03-08 15:35 609  
[   ]de.grobox.liberario_118.apk.json2021-03-13 16:06 609  
[   ]com.github.dfa.diaspora_android.json2022-11-23 07:46 613  
[   ]com.etesync.syncadapter.json2022-11-23 14:04 614  
[   ]org.xphnx.ameixamonochrome.json2022-11-25 20:45 614  
[   ]com.foxykeep.lifecounter_2.apk.json2021-03-10 00:30 616  
[   ]eu.siacs.conversations.json2022-11-25 07:01 616  
[   ]com.wangdaye.mysplash_371.apk.json2021-03-08 22:50 619  
[   ]com.hearham.repeaterstart_3.apk.json2021-03-13 12:46 625  
[   ]it.niedermann.nextcloud.deck.json2022-11-19 10:54 625  
[   ]app.fedilab.fedilabtube_33.apk.json2021-03-13 09:52 626  
[   ]com.github.premnirmal.tickerwidget.json2022-11-23 06:28 626  
[   ]com.orgzly_117.apk.json2021-03-09 08:17 628  
[   ]com.metinkale.prayer_215.apk.json2021-03-09 13:14 630  
[   ]budo.budoist_33.apk.json2021-02-27 14:18 632  
[   ]me.zhanghai.android.files_23.apk.json2022-02-04 10:48 632  
[   ]com.kabouzeid.gramophone_176.apk.json2021-03-09 16:37 634  
[   ]com.kabouzeid.gramophone_177.apk.json2021-04-02 09:37 634  
[   ]com.kabouzeid.gramophone_179.apk.json2021-03-13 12:58 634  
[   ]com.tunjid.fingergestures_48.apk.json2021-03-09 01:23 634  
[   ]com.u17od.upm_20.apk.json2021-03-09 01:05 634  
[   ]org.billthefarmer.editor.json2022-11-17 16:48 637  
[   ]net.sourceforge.dibdib.android.dib2qm.json2022-11-18 00:15 641  
[   ]player.efis.pfd.json2022-11-25 19:18 644  
[   ]net.ivpn.client_94.apk.json2022-03-20 15:40 647  
[   ]com.owncloud.android.json2022-11-22 08:02 649  
[   ]com.github.axet.audiorecorder.json2022-11-23 09:12 651  
[   ]com.nutomic.syncthingandroid.json2022-11-22 09:27 651  
[   ]com.beckhamd.nasaimageryfetcher_7.apk.json2021-04-02 08:54 653  
[   ]com.nkanaev.comics_7.apk.json2021-03-09 10:01 662  
[   ]it.niedermann.owncloud.notes.json2022-11-19 10:15 663  
[   ]com.uberspot.a2048_24.apk.json2021-03-09 00:57 664  
[   ]com.pvpc.precio_luz_2.apk.json2021-03-15 08:23 666  
[   ]com.jarsilio.android.waveup.json2022-11-23 00:43 667  
[   ]com.stoutner.privacybrowser.standard.json2022-11-21 23:21 667  
[   ]com.biglybt.android.client_1030106.apk.json2021-03-13 11:20 668  
[   ]com.f2prateek.dfg_113.apk.json2021-03-10 00:53 668  
[   ]com.gladis.tictactoe_1.apk.json2021-03-09 21:07 670  
[   ]com.podverse.fdroid_2.apk.json2021-03-14 07:58 670  
[   ]com.mridang.cellinfo_4.apk.json2021-03-09 11:51 674  
[   ]com.mridang.wifiinfo_3.apk.json2021-03-09 11:46 674  
[   ]be.mygod.vpnhotspot_220.apk.json2021-04-02 08:27 678  
[   ]de.grobox.liberario_112.apk.json2021-03-08 15:37 679  
[   ]de.grobox.liberario_113.apk.json2021-03-08 15:36 679  
[   ]com.qubling.sidekick_16.apk.json2021-03-09 06:33 680  
[   ]fr.cph.chicago.foss_205.apk.json2022-02-05 16:37 681  
[   ]org.moire.ultrasonic_91.apk.json2022-03-19 03:58 681  
[   ]com.amaze.filemanager_77.apk.json2021-03-10 16:31 683  
[   ]com.metinkale.prayer_174.apk.json2021-03-09 13:20 686  
[   ]app.pott.kaffeepott.androidclient_10104.apk.json2021-03-13 10:04 689  
[   ]com.simplemobiletools.musicplayer.json2022-11-22 00:07 689  
[   ]com.eventyay.organizer_17.apk.json2021-03-10 01:18 690  
[   ]com.amaze.filemanager_54.apk.json2021-03-10 16:40 693  
[   ]com.amaze.filemanager_61.apk.json2021-03-10 16:36 693  
[   ]com.simplemobiletools.gallery.pro.json2022-11-22 00:07 699  
[   ]com.wownero.wownerujo_1130.apk.json2021-03-08 21:54 702  
[   ]com.simplecity.amp_pro_5000.apk.json2021-03-13 14:39 706  
[   ]com.adityakamble49.dcipher_9.apk.json2021-03-10 17:20 707  
[   ]com.bijoysingh.quicknote_145.apk.json2021-03-10 13:04 710  
[   ]com.ferrarid.converterpro_25.apk.json2021-03-15 07:15 710  
[   ]com.ferrarid.converterpro_27.apk.json2021-03-16 07:10 710  
[   ]com.kabouzeid.gramophone_167.apk.json2021-03-09 16:38 710  
[   ]org.billthefarmer.currency.json2022-11-17 16:56 710  
[   ]com.zegoggles.smssync_1557.apk.json2021-03-08 20:19 712  
[   ]org.billthefarmer.diary.json2022-11-17 16:52 712  
[   ]com.adityakamble49.dcipher_10.apk.json2021-03-10 17:21 714  
[   ]de.spiritcroc.riotx_40100430.apk.json2021-03-13 16:29 720  
[   ]com.money.manager.ex_1000.apk.json2021-03-09 12:42 722  
[   ]com.thirtydegreesray.openhub_30.apk.json2021-03-09 02:46 728  
[   ]nodomain.freeyourgadget.gadgetbridge.json2022-11-17 21:26 733  
[   ]com.foobnix.pro.pdf.reader_4000.apk.json2021-03-15 07:30 746  
[   ]nl.asymmetrics.droidshows.json2022-11-17 21:51 749  
[   ]com.gh4a_71.apk.json2022-11-23 10:24 771  
[   ]de.sudoq_28.apk.json2022-11-20 18:30 771  
[   ]io.pslab_22.apk.json2022-11-19 15:12 771  
[   ]com.gh4a_73.apk.json2022-11-23 10:24 772  
[   ]net.dcnnt_17.apk.json2022-11-18 12:26 774  
[   ]com.iyps_120.apk.json2022-11-23 00:56 775  
[   ]net.dcnnt_19.apk.json2022-11-18 12:26 775  
[   ]de.micmun.android.nextcloudcookbook_140.apk.json2021-03-13 16:19 776  
[   ]net.dcnnt_23.apk.json2022-11-18 12:26 776  
[   ]org.cry.otp_22.apk.json2022-11-17 14:47 776  
[   ]org.cry.otp_23.apk.json2022-11-17 14:47 776  
[   ]net.dcnnt_24.apk.json2022-11-18 12:26 778  
[   ]org.kaqui_78.apk.json2022-11-17 06:49 778  
[   ]ca.momi.lift_2.apk.json2022-11-24 12:55 780  
[   ]de.fff.ccgt_13.apk.json2022-11-21 02:30 780  
[   ]de.fff.ccgt_14.apk.json2022-11-21 02:30 780  
[   ]taco.scoop_28.apk.json2022-11-25 12:14 781  
[   ]com.jerboa_19.apk.json2022-11-23 00:16 783  
[   ]cx.ring_286.apk.json2022-11-21 08:38 783  
[   ]cx.ring_346.apk.json2022-11-21 08:38 783  
[   ]com.orgzly_168.apk.json2022-11-22 08:42 784  
[   ]im.fdx.v2ex_48.apk.json2022-11-20 00:38 784  
[   ]luke.kfz_10002.apk.json2022-11-19 07:07 784  
[   ]luke.kfz_10003.apk.json2022-11-19 07:07 784  
[   ]ogz.tripeaks_5.apk.json2022-11-17 21:08 784  
[   ]ademar.bitac_5.apk.json2022-11-24 15:38 785  
[   ]ademar.bitac_6.apk.json2022-11-24 15:38 785  
[   ]com.ahorcado_7.apk.json2022-11-24 09:26 785  
[   ]me.lucky.red_9.apk.json2022-11-18 20:51 785  
[   ]org.primftpd_53.apk.json2022-11-26 17:33 785  
[   ]com.atr.hiit_3.apk.json2022-11-24 06:48 786  
[   ]im.fdx.v2ex_50.apk.json2022-11-20 00:38 786  
[   ]luke.kfz_10001.apk.json2022-11-19 07:07 786  
[   ]luke.kfz_10004.apk.json2022-11-19 07:07 786  
[   ]com.termux_118.apk.json2022-11-21 22:34 787  
[   ]eu.dfdx.jslab_1.apk.json2022-11-20 11:11 787  
[   ]org.primftpd_54.apk.json2022-11-26 17:33 787  
[   ]itkach.aard2_47.apk.json2022-11-19 11:40 788  
[   ]org.primftpd_59.apk.json2022-11-26 17:33 788  
[   ]ch.bailu.aat_31.apk.json2022-11-24 12:08 789  
[   ]com.github.andremiras.etheroll_721203008.apk.json2021-03-09 23:12 789  
[   ]com.matt.bolton_5.apk.json2022-11-22 16:30 789  
[   ]itkach.aard2_51.apk.json2022-11-19 11:40 789  
[   ]itkach.aard2_53.apk.json2022-11-19 11:40 789  
[   ]ogz.tripeaks_10.apk.json2022-11-17 21:08 789  
[   ]ogz.tripeaks_21.apk.json2022-11-17 21:08 789  
[   ]org.jsl.wfwt_16.apk.json2022-11-17 06:49 789  
[   ]threads.thor_74.apk.json2022-11-25 11:52 789  
[   ]ryey.easer_128.apk.json2022-11-25 14:44 790  
[   ]com.atr.tedit_27.apk.json2022-11-24 06:46 791  
[   ]com.fediphoto_13.apk.json2022-11-23 12:44 791  
[   ]me.lucky.wyfy_8.apk.json2022-11-18 20:51 791  
[   ]rak.pixellwp_11.apk.json2022-11-25 16:50 791  
[   ]com.porg.gugal_9.apk.json2022-11-22 06:25 792  
[   ]cz.hernik.kaku_3.apk.json2022-11-21 08:31 792  
[   ]exa.lnx.a_621.apk.json2022-11-20 07:49 792  
[   ]exa.lnx.a_645.apk.json2022-11-20 07:49 792  
[   ]me.lucky.volta_7.apk.json2022-11-18 20:51 792  
[   ]us.spotco.maps_26.apk.json2022-11-25 09:46 792  
[   ]com.matt.bolton_4.apk.json2022-11-22 16:30 793  
[   ]org.walleth_502.apk.json2022-11-25 22:00 793  
[   ]app.olauncher_30.apk.json2022-11-24 15:06 794  
[   ]app.olauncher_33.apk.json2022-11-24 15:06 794  
[   ]com.atr.tedit_17.apk.json2022-11-24 06:46 794  
[   ]com.meteocool_34.apk.json2022-11-22 15:49 794  
[   ]com.newsblur_202.apk.json2022-11-22 13:35 794  
[   ]de.nproth.pin_12.apk.json2022-11-20 21:38 794  
[   ]foehnix.widget_34.apk.json2022-11-20 07:18 794  
[   ]org.adaway_50500.apk.json2022-11-17 19:36 795  
[   ]org.adaway_60003.apk.json2022-11-17 19:33 795  
[   ]us.spotco.maps_22.apk.json2022-11-25 09:46 795  
[   ]com.pcinpact_268.apk.json2022-11-22 07:50 796  
[   ]com.porg.gugal_5.apk.json2022-11-22 06:25 796  
[   ]com.sleeptimer_8.apk.json2022-11-21 23:49 796  
[   ]com.termux.gui_5.apk.json2022-11-21 22:31 796  
[   ]de.tadris.flang_8.apk.json2022-11-20 17:57 796  
[   ]foehnix.widget_35.apk.json2022-11-20 07:18 796  
[   ]freemap.hikar_16.apk.json2022-11-20 06:47 796  
[   ]gal.sli.singal_21.apk.json2022-11-20 02:19 796  
[   ]in.amfoss.raag_1.apk.json2022-11-19 23:28 796  
[   ]me.ash.reader_13.apk.json2022-11-18 23:06 796  
[   ]me.ash.reader_15.apk.json2022-11-18 23:06 796  
[   ]me.lucky.vibe_17.apk.json2022-11-18 20:51 796  
[   ]me.lucky.volta_8.apk.json2022-11-18 20:51 796  
[   ]org.qosp.notes_6.apk.json2022-11-26 15:41 796  
[   ]org.qosp.notes_8.apk.json2022-11-26 15:41 796  
[   ]threads.thor_114.apk.json2022-11-25 11:52 796  
[   ]threads.thor_122.apk.json2022-11-25 11:52 796  
[   ]us.spotco.maps_18.apk.json2022-11-25 09:47 796  
[   ]com.evilinsult_38.apk.json2022-11-23 13:31 797  
[   ]com.mlkyh.hertz_5.apk.json2022-11-22 15:19 797  
[   ]com.termux.api_48.apk.json2022-11-21 22:31 797  
[   ]de.bwl.lfdi.app_2.apk.json2022-11-21 05:30 797  
[   ]de.nproth.pin_16.apk.json2022-11-20 21:38 797  
[   ]me.lucky.sentry_7.apk.json2022-11-18 20:51 797  
[   ]app.olauncher_37.apk.json2022-11-24 15:06 798  
[   ]app.olauncher_41.apk.json2022-11-24 15:06 798  
[   ]app.olauncher_44.apk.json2022-11-24 15:06 798  
[   ]com.chao.app_313.apk.json2022-11-23 20:47 798  
[   ]com.chao.app_314.apk.json2022-11-23 20:47 798  
[   ]de.nproth.pin_17.apk.json2022-11-20 21:38 798  
[   ]io.heckel.ntfy_15.apk.json2022-11-19 16:18 798  
[   ]org.xbmc.kore_29.apk.json2022-11-25 21:03 798  
[   ]org.xbmc.kore_31.apk.json2022-11-25 21:03 798  
[   ]com.apk.editor_14.apk.json2022-11-24 07:09 799  
[   ]com.daemon.ssh_16.apk.json2022-11-23 18:19 799  
[   ]de.asmw.flindex_6.apk.json2022-11-21 08:04 799  
[   ]dubrowgn.wattz_11.apk.json2022-11-20 12:37 799  
[   ]io.heckel.ntfy_23.apk.json2022-11-19 16:18 799  
[   ]org.scoutant.rpn_4.apk.json2022-11-26 08:43 799  
[   ]com.apk.editor_24.apk.json2022-11-24 07:09 800  
[   ]es.eoinrul.ecwt_43.apk.json2022-11-20 11:33 800  
[   ]me.lucky.duress_9.apk.json2022-11-18 20:52 800  
[   ]player.efis.pfd_43.apk.json2022-11-25 19:18 800  
[   ]com.apk.editor_12.apk.json2022-11-24 07:09 801  
[   ]com.apk.editor_23.apk.json2022-11-24 07:09 801  
[   ]com.ero.kinoko_95.apk.json2022-11-23 14:22 801  
[   ]es.eoinrul.ecwt_41.apk.json2022-11-20 11:34 801  
[   ]es.eoinrul.ecwt_44.apk.json2022-11-20 11:33 801  
[   ]inc.flide.vi8_7.apk.json2022-11-19 22:50 801  
[   ]io.rebble.charon_5.apk.json2022-11-19 15:12 801  
[   ]me.lucky.aodify_3.apk.json2022-11-18 20:52 801  
[   ]me.lucky.sentry_9.apk.json2022-11-18 20:51 801  
[   ]net.gitsaibot.af_3.apk.json2022-11-18 11:55 801  
[   ]net.gitsaibot.af_9.apk.json2022-11-18 11:55 801  
[   ]org.decsync.cc_35.apk.json2022-11-17 14:31 801  
[   ]player.efis.pfd_46.apk.json2022-11-25 19:18 801  
[   ]rs.ltt.android_14.apk.json2022-11-25 16:38 801  
[   ]com.DartChecker_19.apk.json2022-11-23 17:56 802  
[   ]com.bnyro.trivia_8.apk.json2022-11-24 00:05 802  
[   ]com.chess.clock_11.apk.json2022-11-23 20:43 802  
[   ]com.rechnen.app_20.apk.json2022-11-22 04:41 802  
[   ]com.termux.api_51.apk.json2022-11-21 22:31 802  
[   ]inc.flide.vi8_9.apk.json2022-11-19 22:50 802  
[   ]player.efis.cfd_43.apk.json2022-11-25 19:42 802  
[   ]player.efis.mfd_43.apk.json2022-11-25 19:21 802  
[   ]site.leos.setter_7.apk.json2022-11-25 13:17 802  
[   ]com.DartChecker_23.apk.json2022-11-23 17:55 803  
[   ]com.bobek.compass_8.apk.json2022-11-23 23:53 803  
[   ]com.icebem.akt_64.apk.json2022-11-23 02:21 803  
[   ]com.omelan.cofi_77.apk.json2022-11-22 08:49 803  
[   ]com.unciv.app_543.apk.json2022-11-21 18:35 803  
[   ]io.heckel.ntfy_27.apk.json2022-11-19 16:18 803  
[   ]io.heckel.ntfy_28.apk.json2022-11-19 16:18 803  
[   ]me.lucky.clipeus_6.apk.json2022-11-18 20:52 803  
[   ]net.ser1.forage_39.apk.json2022-11-18 00:42 803  
[   ]player.efis.pfd_51.apk.json2022-11-25 19:18 803  
[   ]at.h4x.awhip_10100.apk.json2022-11-24 13:58 804  
[   ]com.unciv.app_552.apk.json2022-11-21 18:35 804  
[   ]de.kromke.andreas.unpopmusicplayerfree.json2022-11-20 23:35 804  
[   ]org.sensors2.osc_9.apk.json2022-11-26 07:25 804  
[   ]player.efis.pfd_53.apk.json2022-11-25 19:18 804  
[   ]com.DartChecker_25.apk.json2022-11-23 17:55 805  
[   ]com.bobek.compass_7.apk.json2022-11-23 23:53 805  
[   ]com.omelan.cofi_88.apk.json2022-11-22 08:49 805  
[   ]in.shick.diode_26.apk.json2022-11-19 21:02 805  
[   ]me.lucky.wasted_39.apk.json2022-11-18 20:51 805  
[   ]nl.viter.glider_38.apk.json2022-11-17 21:33 805  
[   ]org.fdroid.nearby_2.apk.json2022-11-17 12:01 805  
[   ]org.sensors2.osc_5.apk.json2022-11-26 07:25 805  
[   ]threads.server_245.apk.json2022-11-25 11:52 805  
[   ]threads.server_298.apk.json2022-11-25 11:52 805  
[   ]com.DartChecker_18.apk.json2022-11-23 17:56 806  
[   ]com.DartChecker_26.apk.json2022-11-23 17:55 806  
[   ]com.aistra.hail_18.apk.json2022-11-24 09:26 806  
[   ]com.easyfitness_55.apk.json2022-11-23 15:42 806  
[   ]com.xinto.mauth_40.apk.json2022-11-21 15:19 806  
[   ]de.jepfa.bdt_10000.apk.json2022-11-21 01:25 806  
[   ]de.moekadu.tuner_7.apk.json2022-11-20 22:36 806  
[   ]me.lucky.catcher_1.apk.json2022-11-18 20:52 806  
[   ]me.lucky.duress_10.apk.json2022-11-18 20:52 806  
[   ]me.lucky.reactor_6.apk.json2022-11-18 20:52 806  
[   ]me.lucky.wasted_37.apk.json2022-11-18 20:51 806  
[   ]nl.viter.glider_23.apk.json2022-11-17 21:33 806  
[   ]nl.viter.glider_40.apk.json2022-11-17 21:33 806  
[   ]threads.server_246.apk.json2022-11-25 11:52 806  
[   ]threads.server_282.apk.json2022-11-25 11:52 806  
[   ]app.olaunchercf_21.apk.json2022-11-24 15:06 807  
[   ]cc.calliope.mini_12.apk.json2022-11-24 12:35 807  
[   ]ch.famoser.mensa_18.apk.json2022-11-24 11:47 807  
[   ]com.bnyro.trivia_13.apk.json2022-11-24 00:06 807  
[   ]com.bobek.compass_5.apk.json2022-11-23 23:53 807  
[   ]com.dosse.dozeoff_1.apk.json2022-11-23 16:24 807  
[   ]com.dosse.dozeoff_2.apk.json2022-11-23 16:24 807  
[   ]com.dosse.dozeoff_3.apk.json2022-11-23 16:24 807  
[   ]com.example.TTime_3.apk.json2022-11-23 13:01 807  
[   ]com.headi.app_1108.apk.json2022-11-23 03:10 807  
[   ]com.jstephan.yarc_5.apk.json2022-11-22 23:14 807  
[   ]fr.neamar.kiss_197.apk.json2022-11-20 03:50 807  
[   ]gal.sli.digalnet_15.apk.json2022-11-20 02:19 807  
[   ]juloo.keyboard2_24.apk.json2022-11-19 08:44 807  
[   ]net.taler.cashier_2.apk.json2022-11-17 23:01 807  
[   ]org.decsync.flym_46.apk.json2022-11-17 14:29 807  
[   ]player.efis.cfd_44.apk.json2022-11-25 19:42 807  
[   ]player.efis.mfd_44.apk.json2022-11-25 19:21 807  
[   ]posidon.launcher_67.apk.json2022-11-25 17:34 807  
[   ]app.olaunchercf_11.apk.json2022-11-24 15:06 808  
[   ]com.aistra.hail_19.apk.json2022-11-24 09:26 808  
[   ]com.sweak.qralarm_7.apk.json2022-11-21 23:14 808  
[   ]edu.rit.csh.devin_5.apk.json2022-11-20 11:48 808  
[   ]fr.neamar.kiss_187.apk.json2022-11-20 03:50 808  
[   ]juloo.keyboard2_26.apk.json2022-11-19 08:44 808  
[   ]org.windvolt_20210.apk.json2022-11-25 21:28 808  
[   ]com.aravi.dot_30009.apk.json2022-11-24 06:56 809  
[   ]com.luk.saucenao_15.apk.json2022-11-22 18:03 809  
[   ]de.moekadu.tuner_18.apk.json2022-11-20 22:36 809  
[   ]com.alovoa.alovoa_4.apk.json2022-11-24 09:02 810  
[   ]com.best.deskclock_3.apk.json2022-11-24 01:39 810  
[   ]com.dosse.airpods_14.apk.json2022-11-23 16:28 810  
[   ]com.headi.app_1110.apk.json2022-11-23 03:10 810  
[   ]com.iven.iconify_42.apk.json2022-11-23 01:04 810  
[   ]com.iven.iconify_52.apk.json2022-11-23 01:04 810  
[   ]com.readrops.app_14.apk.json2022-11-22 04:41 810  
[   ]com.termoneplus_353.apk.json2022-11-21 22:40 810  
[   ]dev.patri9ck.a2ln_6.apk.json2022-11-20 14:37 810  
[   ]eu.faircode.xlua_133.apk.json2022-11-20 10:49 810  
[   ]eu.lepiller.nani_16.apk.json2022-11-20 10:09 810  
[   ]fr.neamar.kiss_196.apk.json2022-11-20 03:50 810  
[   ]io.mainframe.hacs_53.apk.json2022-11-19 15:48 810  
[   ]pc.javier.seguime_53.apk.json2022-11-25 19:43 810  
[   ]town.robin.toadua_5.apk.json2022-11-25 11:29 810  
[   ]at.h4x.amsprung_105.apk.json2022-11-24 13:59 811  
[   ]ch.famoser.mensa_19.apk.json2022-11-24 11:47 811  
[   ]com.adgad.kboard_40.apk.json2022-11-24 09:34 811  
[   ]com.adgad.kboard_41.apk.json2022-11-24 09:34 811  
[   ]com.alovoa.alovoa_6.apk.json2022-11-24 09:02 811  
[   ]com.aravi.dot_30105.apk.json2022-11-24 06:56 811  
[   ]com.asdoi.gymwen_130.apk.json2022-11-24 06:52 811  
[   ]com.aurora.adroid_8.apk.json2022-11-24 06:46 811  
[   ]com.aurora.store_33.apk.json2022-11-24 06:45 811  
[   ]com.aurora.store_36.apk.json2022-11-24 06:45 811  
[   ]com.aurora.store_38.apk.json2022-11-24 06:45 811  
[   ]com.aurora.store_41.apk.json2022-11-24 06:45 811  
[   ]com.cax.pmk.ext_331.apk.json2022-11-23 22:19 811  
[   ]com.gyorog.polycal_7.apk.json2022-11-23 04:00 811  
[   ]com.minar.birday_15.apk.json2022-11-22 15:43 811  
[   ]com.minar.birday_21.apk.json2022-11-22 15:43 811  
[   ]com.nicue.onetwo_15.apk.json2022-11-22 11:53 811  
[   ]com.powerje.nyan_15.apk.json2022-11-22 05:49 811  
[   ]com.ruesga.rview_69.apk.json2022-11-22 03:49 811  
[   ]com.termoneplus_352.apk.json2022-11-21 22:40 811  
[   ]com.termoneplus_354.apk.json2022-11-21 22:40 811  
[   ]com.termoneplus_360.apk.json2022-11-21 22:40 811  
[   ]com.termux.tasker_6.apk.json2022-11-21 22:27 811  
[   ]com.tuyafeng.watt_4.apk.json2022-11-21 19:47 811  
[   ]de.moroway.oc_70107.apk.json2022-11-20 21:47 811  
[   ]de.mw136.tonuino_26.apk.json2022-11-20 21:44 811  
[   ]dev.patri9ck.a2ln_9.apk.json2022-11-20 14:37 811  
[   ]exe.bbllw8.anemo_14.apk.json2022-11-20 07:49 811  
[   ]exe.bbllw8.anemo_15.apk.json2022-11-20 07:49 811  
[   ]ltd.evilcorp.atox_9.apk.json2022-11-19 07:10 811  
[   ]me.lucky.silence_48.apk.json2022-11-18 20:51 811  
[   ]mobi.meddle.wehe_47.apk.json2022-11-18 18:50 811  
[   ]ooo.akito.webmon_13.apk.json2022-11-17 20:30 811  
[   ]org.ebur.debitum_22.apk.json2022-11-17 12:56 811  
[   ]org.mian.gitnex_351.apk.json2022-11-17 01:11 811  
[   ]com.plexer0.nitter_9.apk.json2022-11-22 06:40 812  
[   ]com.series.anlight_2.apk.json2022-11-22 01:33 812  
[   ]de.monocles.social_4.apk.json2022-11-20 21:48 812  
[   ]me.lucky.silence_50.apk.json2022-11-18 20:51 812  
[   ]org.schabi.stethox_2.apk.json2022-11-26 08:48 812  
[   ]pl.lebihan.network_1.apk.json2022-11-25 19:12 812  
[   ]xyz.myachin.saveto_8.apk.json2022-11-25 09:01 812  
[   ]app.weatheroverview_1.apk.json2022-11-24 14:56 813  
[   ]de.beowulf.wetter_37.apk.json2022-11-21 06:58 813  
[   ]eu.quelltext.memory_7.apk.json2022-11-20 09:00 813  
[   ]io.github.chiver_210.apk.json2022-11-19 20:41 813  
[   ]net.xvello.salasana_3.apk.json2022-11-17 21:57 813  
[   ]org.ogre.browser_17.apk.json2022-11-16 20:22 813  
[   ]com.asdoi.gymwen_121.apk.json2022-11-24 06:52 814  
[   ]com.memetro.android_1.apk.json2022-11-22 16:08 814  
[   ]com.termoneplus_401.apk.json2022-11-21 22:39 814  
[   ]me.ranko.autodark_11.apk.json2022-11-18 20:33 814  
[   ]org.baitmooth.snow_1.apk.json2022-11-17 17:15 814  
[   ]org.calantas.mygeo_1.apk.json2022-11-17 16:08 814  
[   ]org.dmfs.tasks_82200.apk.json2022-11-17 13:18 814  
[   ]org.oxycblt.auxio_18.apk.json2022-11-16 16:14 814  
[   ]org.xphnx.ameixa_481.apk.json2022-11-25 20:48 814  
[   ]org.xphnx.ameixa_491.apk.json2022-11-25 20:48 814  
[   ]com.bobek.metronome_2.apk.json2022-11-23 23:53 815  
[   ]com.github.gotify_25.apk.json2022-11-23 07:25 815  
[   ]com.iven.iconify_58.apk.json2022-11-23 01:04 815  
[   ]com.iven.iconify_59.apk.json2022-11-23 01:04 815  
[   ]com.tioui.opensound_5.apk.json2022-11-21 22:13 815  
[   ]me.ranko.autodark_13.apk.json2022-11-18 20:33 815  
[   ]moe.dic1911.autodnd_3.apk.json2022-11-18 18:49 815  
[   ]net.tjado.usbgadget_4.apk.json2022-11-17 22:41 815  
[   ]subins2000.manglish_7.apk.json2022-11-25 13:08 815  
[   ]xyz.myachin.saveto_12.apk.json2022-11-25 09:01 815  
[   ]at.h4x.metaapp_10102.apk.json2022-11-24 13:58 816  
[   ]ca.snoe.deedum_16.apk.json2022-11-24 12:43 816  
[   ]com.dosse.airpods_16.apk.json2022-11-23 16:28 816  
[   ]com.dosse.airpods_22.apk.json2022-11-23 16:28 816  
[   ]com.github.gotify_20.apk.json2022-11-23 07:26 816  
[   ]com.github.gotify_22.apk.json2022-11-23 07:26 816  
[   ]com.github.gotify_26.apk.json2022-11-23 07:25 816  
[   ]com.minar.randomix_37.apk.json2022-11-22 15:42 816  
[   ]com.minar.randomix_38.apk.json2022-11-22 15:42 816  
[   ]com.unciv.app_564.apk.json2022-11-21 18:35 816  
[   ]com.waist.line_30404.apk.json2022-11-21 16:52 816  
[   ]de.beowulf.wetter_33.apk.json2022-11-21 06:59 816  
[   ]de.dm1ri.totalog_102.apk.json2022-11-21 03:45 816  
[   ]de.monocles.browser_7.apk.json2022-11-20 22:36 816  
[   ]de.tap.easy_xkcd_187.apk.json2022-11-20 17:45 816  
[   ]io.github.chiver_111.apk.json2022-11-19 20:41 816  
[   ]io.github.chiver_211.apk.json2022-11-19 20:40 816  
[   ]io.mainframe.hacs_54.apk.json2022-11-19 15:48 816  
[   ]io.mainframe.hacs_56.apk.json2022-11-19 15:48 816  
[   ]me.ocv.partyup_10600.apk.json2022-11-18 20:34 816  
[   ]me.ranko.autodark_15.apk.json2022-11-18 20:33 816  
[   ]mf.asciitext.lite_16.apk.json2022-11-18 19:55 816  
[   ]moe.matsuri.lite_815.apk.json2022-11-18 18:43 816  
[   ]org.dmfs.tasks_81600.apk.json2022-11-17 13:18 816  
[   ]org.pgnapps.pk2_1027.apk.json2022-11-26 17:45 816  
[   ]org.xphnx.ameixa_470.apk.json2022-11-25 20:48 816  
[   ]org.xphnx.ameixa_472.apk.json2022-11-25 20:48 816  
[   ]com.chesire.pushie_13.apk.json2022-11-23 20:43 817  
[   ]com.github.cythara_23.apk.json2022-11-23 08:10 817  
[   ]com.unciv.app_545.apk.json2022-11-21 18:35 817  
[   ]de.monocles.browser_5.apk.json2022-11-20 22:36 817  
[   ]de.nulide.shiftcal_15.apk.json2022-11-20 21:35 817  
[   ]es.ideotec.t16fling_3.apk.json2022-11-20 11:31 817  
[   ]fr.nuage.souvenirs_12.apk.json2022-11-20 03:38 817  
[   ]moe.matsuri.lite_775.apk.json2022-11-18 18:44 817  
[   ]org.traccar.client_79.apk.json2022-11-26 00:14 817  
[   ]com.termux.window_15.apk.json2022-11-21 22:27 818  
[   ]de.beowulf.wetter_58.apk.json2022-11-21 06:58 818  
[   ]de.smasi.tickmate_46.apk.json2022-11-20 19:37 818  
[   ]de.smasi.tickmate_48.apk.json2022-11-20 19:37 818  
[   ]org.ttrssreader_1963.apk.json2022-11-25 23:48 818  
[   ]org.y20k.escapepod_39.apk.json2022-11-25 20:36 818  
[   ]ademar.textlauncher_8.apk.json2022-11-24 15:38 819  
[   ]bluepie.ad_silence_40.apk.json2022-11-24 13:13 819  
[   ]com.gianlu.dnshero_31.apk.json2022-11-23 10:14 819  
[   ]com.minar.randomix_31.apk.json2022-11-22 15:42 819  
[   ]com.minar.randomix_32.apk.json2022-11-22 15:42 819  
[   ]jp.takke.datastats_29.apk.json2022-11-19 08:48 819  
[   ]me.tsukanov.counter_23.apk.json2022-11-18 20:07 819  
[   ]me.tsukanov.counter_24.apk.json2022-11-18 20:07 819  
[   ]net.vonforst.evmap_94.apk.json2022-11-17 22:27 819  
[   ]org.brightdv.boxbox_8.apk.json2022-11-17 16:11 819  
[   ]org.traccar.client_78.apk.json2022-11-26 00:14 819  
[   ]org.y20k.escapepod_32.apk.json2022-11-25 20:36 819  
[   ]xyz.myachin.saveto_11.apk.json2022-11-25 09:01 819  
[   ]co.prestosole.clima_9.apk.json2022-11-21 13:35 820  
[   ]com.amanoteam.unalix_9.apk.json2022-11-24 09:02 820  
[   ]com.asdoi.timetable_16.apk.json2022-11-24 06:51 820  
[   ]com.blockbasti.justanotherworkouttimer_20210311.apk.json2021-04-02 08:59 820  
[   ]com.danhasting.radar_6.apk.json2022-11-23 18:16 820  
[   ]com.lako.walletcount_3.apk.json2022-11-22 21:17 820  
[   ]com.simplytranslate_2.apk.json2022-11-21 23:55 820  
[   ]de.moooon.acrylicons_8.apk.json2022-11-20 21:47 820  
[   ]de.nulide.shiftcal_16.apk.json2022-11-20 21:35 820  
[   ]com.blockbasti.justanotherworkouttimer_20210227.apk.json2021-03-15 06:57 821  
[   ]com.pjuu.otterdroid_8.apk.json2022-11-22 06:49 821  
[   ]com.podverse.fdroid_6.apk.json2022-11-22 06:34 821  
[   ]com.ulicae.cinelog_32.apk.json2022-11-21 19:13 821  
[   ]com.ulicae.cinelog_35.apk.json2022-11-21 19:13 821  
[   ]de.nulide.shiftcal_13.apk.json2022-11-20 21:35 821  
[   ]es.ideotec.t16fling_4.apk.json2022-11-20 11:31 821  
[   ]fr.nuage.souvenirs_13.apk.json2022-11-20 03:38 821  
[   ]net.gaast.giggity_520.apk.json2022-11-18 12:01 821  
[   ]org.andstatus.app_343.apk.json2022-11-17 18:20 821  
[   ]org.anothermonitor_10.apk.json2022-11-17 18:20 821  
[   ]org.nitri.opentopo_26.apk.json2022-11-16 21:04 821  
[   ]org.nitri.opentopo_29.apk.json2022-11-16 21:04 821  
[   ]org.stingle.photos_45.apk.json2022-11-26 04:38 821  
[   ]org.tessoft.qonvert_7.apk.json2022-11-26 02:05 821  
[   ]org.tessoft.qonvert_8.apk.json2022-11-26 02:05 821  
[   ]org.xphnx.ameixa_4100.apk.json2022-11-25 20:50 821  
[   ]org.y20k.escapepod_34.apk.json2022-11-25 20:36 821  
[   ]org.y20k.escapepod_35.apk.json2022-11-25 20:36 821  
[   ]org.y20k.trackbook_50.apk.json2022-11-25 20:35 821  
[   ]com.autismprime.fall_2.apk.json2022-11-24 06:45 822  
[   ]com.danhasting.radar_4.apk.json2022-11-23 18:16 822  
[   ]com.fmsys.snapdrop_26.apk.json2022-11-23 12:25 822  
[   ]com.github.cetoolbox_5.apk.json2022-11-23 08:13 822  
[   ]com.memetro.android_13.apk.json2022-11-22 16:08 822  
[   ]com.mikifus.padland_23.apk.json2022-11-22 15:46 822  
[   ]com.mikifus.padland_24.apk.json2022-11-22 15:46 822  
[   ]com.omgodse.notally_42.apk.json2022-11-22 08:49 822  
[   ]com.omgodse.notally_43.apk.json2022-11-22 08:49 822  
[   ]de.baumann.browser_135.apk.json2022-11-21 07:46 822  
[   ]de.blau.android_2106.apk.json2022-11-21 06:38 822  
[   ]de.mwvb.blockpuzzle_70.apk.json2022-11-20 21:44 822  
[   ]fr.ralala.hexviewer_28.apk.json2022-11-20 03:07 822  
[   ]org.nitri.opentopo_34.apk.json2022-11-16 21:04 822  
[   ]us.spotco.extirpater_27.apk.json2022-11-25 09:47 822  
[   ]com.dkanada.icecons_44.apk.json2022-11-23 16:51 823  
[   ]com.fmsys.snapdrop_29.apk.json2022-11-23 12:25 823  
[   ]com.gianlu.dnshero_39.apk.json2022-11-23 10:14 823  
[   ]com.oF2pks.jquarks_14.apk.json2022-11-22 09:03 823  
[   ]com.oF2pks.jquarks_17.apk.json2022-11-22 09:03 823  
[   ]com.vlille.checker_762.apk.json2022-11-21 17:09 823  
[   ]io.github.dkter.aaaaa_2.apk.json2022-11-19 20:18 823  
[   ]io.github.dkter.aaaaa_4.apk.json2022-11-19 20:18 823  
[   ]org.asteroidos.sync_21.apk.json2022-11-17 18:08 823  
[   ]org.asteroidos.sync_22.apk.json2022-11-17 18:07 823  
[   ]org.asteroidos.sync_24.apk.json2022-11-17 18:07 823  
[   ]org.ietf.ietfsched_55.apk.json2022-11-17 07:55 823  
[   ]org.jak_linux.dns66_29.apk.json2022-11-17 07:01 823  
[   ]timur.webrtc.check_10.apk.json2022-11-25 11:51 823  
[   ]ca.hamaluik.timecop_43.apk.json2022-11-24 12:56 824  
[   ]com.better.alarm_30701.apk.json2022-11-24 01:38 824  
[   ]com.flxrs.dankchat_265.apk.json2022-11-23 12:25 824  
[   ]com.mhss.app.mybrain_2.apk.json2022-11-22 15:49 824  
[   ]com.sapuseven.untis_34.apk.json2022-11-22 02:45 824  
[   ]com.tananaev.logcat_13.apk.json2022-11-21 23:00 824  
[   ]de.selfnet.wifisetup_6.apk.json2022-11-20 19:53 824  
[   ]fr.emersion.goguma_712.apk.json2022-11-20 05:45 824  
[   ]fr.ralala.hexviewer_12.apk.json2022-11-20 03:08 824  
[   ]fr.ralala.hexviewer_29.apk.json2022-11-20 03:07 824  
[   ]info.tangential.task_8.apk.json2022-11-19 21:25 824  
[   ]org.asteroidos.sync_20.apk.json2022-11-17 18:08 824  
[   ]org.biotstoiq.launch_8.apk.json2022-11-17 16:31 824  
[   ]app.fedilab.tubelab_45.apk.json2022-11-24 15:23 825  
[   ]com.benny.pxerstudio_9.apk.json2022-11-24 01:56 825  
[   ]com.dkanada.icecons_45.apk.json2022-11-23 16:51 825  
[   ]com.flxrs.dankchat_142.apk.json2022-11-23 12:26 825  
[   ]com.flxrs.dankchat_258.apk.json2022-11-23 12:25 825  
[   ]com.mendhak.sheepyhorn_4.apk.json2022-11-22 15:51 825  
[   ]com.starry.greenstash_7.apk.json2022-11-21 23:34 825  
[   ]danielmeek32.compass_2.apk.json2022-11-21 08:10 825  
[   ]de.baumann.browser_111.apk.json2022-11-21 07:46 825  
[   ]de.determapp.android_8.apk.json2022-11-21 03:55 825  
[   ]de.k3b.android.calef_5.apk.json2022-11-21 00:49 825  
[   ]de.tu_chemnitz.wlan_19.apk.json2022-11-20 16:35 825  
[   ]dev.melonpan.kotori_29.apk.json2022-11-20 14:40 825  
[   ]net.moasdawiki.app_26.apk.json2022-11-18 10:04 825  
[   ]net.moasdawiki.app_30.apk.json2022-11-18 10:04 825  
[   ]org.poul.bits.android_4.apk.json2022-11-26 17:37 825  
[   ]org.scoutant.blokish_22.apk.json2022-11-26 08:44 825  
[   ]org.woheller69.level_16.apk.json2022-11-25 21:26 825  
[   ]us.spotco.motionlock_17.apk.json2022-11-25 09:46 825  
[   ]at.bitfire.icsdroid_64.apk.json2022-11-24 14:00 826  
[   ]com.antonok.warpclock_2.apk.json2022-11-24 07:45 826  
[   ]com.benny.pxerstudio_8.apk.json2022-11-24 01:56 826  
[   ]com.dkanada.icecons_46.apk.json2022-11-23 16:51 826  
[   ]com.gh4a_62.apk.json2022-11-23 10:29 826  
[   ]com.klee.volumelockr_8.apk.json2022-11-22 22:07 826  
[   ]com.krawieck.lemmur_12.apk.json2022-11-22 21:49 826  
[   ]com.krawieck.lemmur_16.apk.json2022-11-22 21:49 826  
[   ]com.krawieck.lemmur_20.apk.json2022-11-22 21:42 826  
[   ]com.madlonkay.orgro_47.apk.json2022-11-22 17:18 826  
[   ]com.nazmar.dicegainz_3.apk.json2022-11-22 13:54 826  
[   ]com.nazmar.dicegainz_4.apk.json2022-11-22 13:54 826  
[   ]com.nyxkn.meditation_7.apk.json2022-11-22 09:27 826  
[   ]com.nyxkn.meditation_8.apk.json2022-11-22 09:27 826  
[   ]com.oF2pks.adbungfu_17.apk.json2022-11-22 09:06 826  
[   ]com.sapuseven.untis_33.apk.json2022-11-22 02:45 826  
[   ]com.serwylo.beatgame_3.apk.json2022-11-22 01:30 826  
[   ]com.serwylo.beatgame_8.apk.json2022-11-22 01:30 826  
[   ]de.grobox.blitzmail_14.apk.json2022-11-21 02:05 826  
[   ]de.schlikk.calls_100000.apk.json2022-11-20 19:53 826  
[   ]eu.quelltext.counting_3.apk.json2022-11-20 09:01 826  
[   ]fr.emersion.goguma_583.apk.json2022-11-20 05:45 826  
[   ]info.tangential.task_9.apk.json2022-11-19 21:25 826  
[   ]io.bmaupin.pitchpipe_7.apk.json2022-11-19 20:46 826  
[   ]oppen.gemini.ariane_42.apk.json2022-11-17 19:36 826  
[   ]org.biotstoiq.launch_9.apk.json2022-11-17 16:31 826  
[   ]org.schabi.newpipe_987.apk.json2022-11-26 08:59 826  
[   ]org.tengel.timescale_9.apk.json2022-11-26 02:05 826  
[   ]org.tether.tether_2130.apk.json2022-11-26 02:04 826  
[   ]org.y20k.transistor_91.apk.json2022-11-25 20:31 826  
[   ]pw.thedrhax.mosmetro_75.apk.json2022-11-25 16:53 826  
[   ]simbio.se.nheengare_11.apk.json2022-11-25 13:37 826  
[   ]tube.chikichiki.sako_18.apk.json2022-11-25 11:08 826  
[   ]us.spotco.extirpater_22.apk.json2022-11-25 09:47 826  
[   ]xyz.deepdaikon.quinb_6.apk.json2022-11-25 09:16 826  
[   ]com.antonok.warpclock_3.apk.json2022-11-24 07:45 827  
[   ]com.app.missednotificationsreminder_2010302021.apk.json2021-03-10 14:32 827  
[   ]com.asdoi.quicktiles_14.apk.json2022-11-24 06:52 827  
[   ]com.brackeys.ui_10005.apk.json2022-11-23 23:42 827  
[   ]com.github.rsteube.t4_4.apk.json2022-11-23 06:10 827  
[   ]com.jiaqifeng.hacki_75.apk.json2022-11-23 00:13 827  
[   ]com.kaeruct.gotosleep_5.apk.json2022-11-22 22:48 827  
[   ]com.mzhang.cleantimer_2.apk.json2022-11-22 14:06 827  
[   ]com.perflyst.twire_528.apk.json2022-11-22 07:44 827  
[   ]com.picross.nonocross_3.apk.json2022-11-22 07:18 827  
[   ]com.starry.greenstash_9.apk.json2022-11-21 23:34 827  
[   ]fr.ralala.hexviewer_136.apk.json2022-11-20 03:07 827  
[   ]org.woheller69.level_17.apk.json2022-11-25 21:26 827  
[   ]pw.thedrhax.mosmetro_74.apk.json2022-11-25 16:53 827  
[   ]us.spotco.extirpater_24.apk.json2022-11-25 09:47 827  
[   ]us.spotco.motionlock_14.apk.json2022-11-25 09:46 827  
[   ]us.spotco.motionlock_15.apk.json2022-11-25 09:46 827  
[   ]agrigolo.chubbyclick_19.apk.json2022-11-24 15:38 828  
[   ]app.alextran.immich_30.apk.json2022-11-24 15:29 828  
[   ]at.finderlein.noe_2015.apk.json2022-11-24 14:00 828  
[   ]be.knars.netflixtoimdb_3.apk.json2022-11-24 13:21 828  
[   ]com.better.alarm_31010.apk.json2022-11-24 01:38 828  
[   ]com.biotstoiq.hayago_20.apk.json2022-11-24 01:11 828  
[   ]com.biotstoiq.hayago_21.apk.json2022-11-24 01:11 828  
[   ]com.gh4a_70.apk.json2022-11-23 10:26 828  
[   ]com.jithware.brethap_35.apk.json2022-11-23 00:13 828  
[   ]com.madlonkay.orgro_40.apk.json2022-11-22 17:19 828  
[   ]com.madlonkay.orgro_41.apk.json2022-11-22 17:19 828  
[   ]de.moekadu.metronome_33.apk.json2022-11-20 22:36 828  
[   ]de.moooon.acrylicons_11.apk.json2022-11-20 21:47 828  
[   ]de.nucleus.foss_warn_15.apk.json2022-11-20 21:38 828  
[   ]de.sudoq_41.apk.json2022-11-20 18:30 828  
[   ]fr.nihilus.music_201010.apk.json2022-11-20 03:47 828  
[   ]it.reyboz.bustorino_32.apk.json2022-11-19 09:58 828  
[   ]it.reyboz.bustorino_42.apk.json2022-11-19 09:58 828  
[   ]org.schabi.newpipe_966.apk.json2022-11-26 09:02 828  
[   ]org.y20k.transistor_85.apk.json2022-11-25 20:31 828  
[   ]agrigolo.chubbyclick_22.apk.json2022-11-24 15:38 829  
[   ]com.celzero.bravedns_20.apk.json2022-11-23 22:08 829  
[   ]com.celzero.bravedns_22.apk.json2022-11-23 22:08 829  
[   ]com.example.trigger_344.apk.json2022-11-23 13:01 829  
[   ]com.github.libretube_16.apk.json2022-11-23 07:16 829  
[   ]com.gluege.nightlight_2.apk.json2022-11-23 05:22 829  
[   ]com.nathanatos.Cuppa_24.apk.json2022-11-22 13:55 829  
[   ]com.serwylo.babyphone_5.apk.json2022-11-22 01:33 829  
[   ]cx.vmx.sdcontacts_10000.apk.json2022-11-21 08:38 829  
[   ]fr.ralala.hexviewer_132.apk.json2022-11-20 03:08 829  
[   ]org.biotstoiq.seshat_11.apk.json2022-11-17 16:31 829  
[   ]org.hlwd.bible_20210323.apk.json2022-11-17 08:25 829  
[   ]oss.krtirtho.spotube_12.apk.json2022-11-25 19:47 829  
[   ]rocks.tbog.tblauncher_39.apk.json2022-11-25 16:45 829  
[   ]uk.org.ngo.squeezer_111.apk.json2022-11-25 09:56 829  
[   ]be.knars.netflixtoimdb_6.apk.json2022-11-24 13:21 830  
[   ]com.activitymanager_511.apk.json2022-11-24 09:35 830  
[   ]com.github.cetoolbox_13.apk.json2022-11-23 08:13 830  
[   ]com.inator.calculator_6.apk.json2022-11-23 02:10 830  
[   ]com.ketanolab.nusimi_7.apk.json2022-11-22 22:20 830  
[   ]com.phstudio.darktheme_6.apk.json2022-11-22 07:23 830  
[   ]es.wolfi.app.passman_15.apk.json2022-11-20 11:26 830  
[   ]it.vfsfitvnm.vimusic_11.apk.json2022-11-19 09:51 830  
[   ]org.pixeldroid.app_17.apk.json2022-11-26 17:41 830  
[   ]ryey.easer.beta_126001.apk.json2022-11-25 14:39 830  
[   ]uk.org.ngo.squeezer_100.apk.json2022-11-25 09:56 830  
[   ]awais.instagrabber_24.apk.json2022-11-24 13:31 831  
[   ]com.activitymanager_415.apk.json2022-11-24 09:35 831  
[   ]com.codedead.deadhash_5.apk.json2022-11-23 20:16 831  
[   ]com.codedead.deadhash_9.apk.json2022-11-23 20:16 831  
[   ]com.dosse.speedtest_9.apk.json2022-11-23 16:24 831  
[   ]com.github.igrmk.smsq_16.apk.json2022-11-23 07:19 831  
[   ]com.junkfood.seal_10020.apk.json2022-11-22 22:51 831  
[   ]com.oF2pks.chairlock_18.apk.json2022-11-22 09:05 831  
[   ]com.serwylo.babybook_10.apk.json2022-11-22 01:33 831  
[   ]com.serwylo.babyphone_9.apk.json2022-11-22 01:32 831  
[   ]com.trisven.safenotes_6.apk.json2022-11-21 20:49 831  
[   ]de.moekadu.metronome_49.apk.json2022-11-20 22:36 831  
[   ]de.moekadu.metronome_51.apk.json2022-11-20 22:36 831  
[   ]de.pixart.messenger_325.apk.json2022-11-20 21:02 831  
[   ]dev.leonlatsch.photok_19.apk.json2022-11-20 14:54 831  
[   ]dev.msfjarvis.aps_11340.apk.json2022-11-20 14:40 831  
[   ]email.schaal.ocreader_59.apk.json2022-11-20 11:34 831  
[   ]fr.nihilus.music_201005.apk.json2022-11-20 03:47 831  
[   ]fr.nocle.passegares_202.apk.json2022-11-20 03:43 831  
[   ]ie.defo.ech_apps_1014051.apk.json2022-11-20 00:38 831  
[   ]it.vfsfitvnm.vimusic_19.apk.json2022-11-19 09:51 831  
[   ]me.hackerchick.catima_66.apk.json2022-11-18 21:07 831  
[   ]net.sylvek.itracing2_82.apk.json2022-11-17 23:04 831  
[   ]org.pixeldroid.app_18.apk.json2022-11-26 17:40 831  
[   ]oss.krtirtho.spotube_15.apk.json2022-11-25 19:47 831  
[   ]pw.thedrhax.mosmetro_77.apk.json2022-11-25 16:53 831  
[   ]rasel.lunar.launcher_23.apk.json2022-11-25 16:50 831  
[   ]uk.org.ngo.squeezer_104.apk.json2022-11-25 09:56 831  
[   ]com.fediphoto.lineage_64.apk.json2022-11-23 12:43 832  
[   ]com.harr1424.listmaker_4.apk.json2022-11-23 03:13 832  
[   ]com.kaeruct.raumballer_3.apk.json2022-11-22 22:48 832  
[   ]com.kazufukurou.nanji_38.apk.json2022-11-22 22:20 832  
[   ]com.maxistar.textpad_31.apk.json2022-11-22 16:14 832  
[   ]com.maxistar.textpad_33.apk.json2022-11-22 16:14 832  
[   ]com.maxistar.textpad_40.apk.json2022-11-22 16:14 832  
[   ]de.monocles.translator_2.apk.json2022-11-20 21:47 832  
[   ]de.monocles.translator_3.apk.json2022-11-20 21:47 832  
[   ]de.qwerty287.ftpclient_8.apk.json2022-11-20 20:43 832  
[   ]dev.danjackson.speaker_5.apk.json2022-11-20 15:09 832  
[   ]godau.fynn.usagedirect_8.apk.json2022-11-20 01:16 832  
[   ]kuesji.link_eye.fdroid_2.apk.json2022-11-19 08:21 832  
[   ]org.paladyn.mediclog_17.apk.json2022-11-16 15:53 832  
[   ]org.transdroid.search_38.apk.json2022-11-25 23:48 832  
[   ]rocks.tbog.tblauncher_25.apk.json2022-11-25 16:45 832  
[   ]rocks.tbog.tblauncher_26.apk.json2022-11-25 16:45 832  
[   ]souch.smp_27.apk.json2022-11-25 13:15 832  
[   ]xyz.myachin.downloader_5.apk.json2022-11-25 09:02 832  
[   ]xyz.myachin.downloader_7.apk.json2022-11-25 09:01 832  
[   ]agrigolo.chubbyclick_14.apk.json2022-11-24 15:38 833  
[   ]br.com.colman.petals_270.apk.json2022-11-24 13:13 833  
[   ]com.celzero.bravedns_16.apk.json2022-11-23 22:19 833  
[   ]com.danefinlay.ttsutil_6.apk.json2022-11-23 18:17 833  
[   ]com.maxistar.textpad_25.apk.json2022-11-22 16:14 833  
[   ]com.serwylo.beatgame_10.apk.json2022-11-22 01:32 833  
[   ]com.serwylo.beatgame_21.apk.json2022-11-22 01:30 833  
[   ]de.beocode.bestbefore_4.apk.json2022-11-21 06:59 833  
[   ]de.chaosdorf.meteroid_41.apk.json2022-11-21 05:21 833  
[   ]de.jl.notificationlog_21.apk.json2022-11-21 01:05 833  
[   ]dev.msfjarvis.aps_11350.apk.json2022-11-20 14:40 833  
[   ]org.btcmap_6.apk.json2022-11-17 16:09 833  
[   ]org.paladyn.mediclog_16.apk.json2022-11-16 15:53 833  
[   ]org.paladyn.mediclog_18.apk.json2022-11-16 15:53 833  
[   ]timur.webcall.callee_98.apk.json2022-11-25 11:51 833  
[   ]cc.kafuu.bilidownload_17.apk.json2022-11-24 12:33 834  
[   ]com.appmindlab.nano_1254.apk.json2022-11-24 07:09 834  
[   ]com.biotstoiq.cryptix_23.apk.json2022-11-24 01:11 834  
[   ]com.donnnno.arcticons_49.apk.json2022-11-23 16:46 834  
[   ]com.fabienli.dokuwiki_63.apk.json2022-11-23 12:58 834  
[   ]com.jens.automation2_104.apk.json2022-11-23 00:26 834  
[   ]com.jens.automation2_122.apk.json2022-11-23 00:26 834  
[   ]com.serwylo.lexica_20007.apk.json2022-11-22 01:25 834  
[   ]com.serwylo.lexica_30007.apk.json2022-11-22 01:25 834  
[   ]com.vrem.wifianalyzer_61.apk.json2022-11-21 16:56 834  
[   ]de.herrmann_engel.rbv_44.apk.json2022-11-21 01:55 834  
[   ]es.ideotec.workouttime_2.apk.json2022-11-20 11:30 834  
[   ]me.bgregos.brighttask_17.apk.json2022-11-18 22:59 834  
[   ]me.hackerchick.catima_67.apk.json2022-11-18 21:07 834  
[   ]me.yardenac.comaphone_27.apk.json2022-11-18 20:01 834  
[   ]net.ktnx.mobileledger_39.apk.json2022-11-18 10:54 834  
[   ]tech.techlore.plexus_100.apk.json2022-11-25 12:08 834  
[   ]us.spotco.ir_remote_1546.apk.json2022-11-25 09:47 834  
[   ]xyz.deepdaikon.zoysii_12.apk.json2022-11-25 09:10 834  
[   ]at.jclehner.rxdroid_9340.apk.json2022-11-24 13:56 835  
[   ]com.dkanada.gramophone_16.apk.json2022-11-23 16:57 835  
[   ]com.fabienli.dokuwiki_62.apk.json2022-11-23 12:58 835  
[   ]com.fabienli.dokuwiki_67.apk.json2022-11-23 12:58 835  
[   ]com.jmstudios.redmoon_39.apk.json2022-11-22 23:29 835  
[   ]com.serwylo.babyphone_10.apk.json2022-11-22 01:33 835  
[   ]com.serwylo.lexica_30008.apk.json2022-11-22 01:25 835  
[   ]com.vrem.wifianalyzer_56.apk.json2022-11-21 16:56 835  
[   ]de.chaosdorf.meteroid_40.apk.json2022-11-21 05:21 835  
[   ]de.nulide.findmydevice_9.apk.json2022-11-20 21:35 835  
[   ]dev.leonlatsch.photok_23.apk.json2022-11-20 14:54 835  
[   ]in.digistorm.aksharam_6.apk.json2022-11-19 22:50 835  
[   ]me.ccrama.redditslide_336.apk.json2022-11-18 21:19 835  
[   ]me.tripsit.tripmobile_16.apk.json2022-11-18 20:11 835  
[   ]org.booncode.bluepass4_5.apk.json2022-11-17 16:11 835  
[   ]org.isoron.uhabits_20101.apk.json2022-11-17 07:20 835  
[   ]org.koitharu.kotatsu_364.apk.json2022-11-17 05:51 835  
[   ]org.moire.ultrasonic_107.apk.json2022-11-17 00:24 835  
[   ]org.woheller69.weather_35.apk.json2022-11-25 21:20 835  
[   ]org.woheller69.weather_55.apk.json2022-11-25 21:18 835  
[   ]rocks.poopjournal.morse_7.apk.json2022-11-25 16:47 835  
[   ]app.intra_64.apk.json2022-11-24 15:16 836  
[   ]aq.metallists.loudbang_41.apk.json2022-11-24 14:56 836  
[   ]aq.metallists.loudbang_47.apk.json2022-11-24 14:54 836  
[   ]ca.chancehorizon.paseo_8.apk.json2022-11-24 13:05 836  
[   ]com.blazecode.tsviewer_5.apk.json2022-11-24 00:33 836  
[   ]com.danefinlay.ttsutil_8.apk.json2022-11-23 18:17 836  
[   ]com.donnnno.arcticons_50.apk.json2022-11-23 16:46 836  
[   ]com.donnnno.arcticons_97.apk.json2022-11-23 16:45 836  
[   ]com.fabienli.dokuwiki_54.apk.json2022-11-23 12:59 836  
[   ]com.github.tmo1.sms_ie_9.apk.json2022-11-23 05:49 836  
[   ]com.gsnathan.pdfviewer_28.apk.json2022-11-23 04:14 836  
[   ]com.jens.automation2_121.apk.json2022-11-23 00:26 836  
[   ]com.jmstudios.redmoon_38.apk.json2022-11-22 23:29 836  
[   ]com.kazufukurou.nanji_37.apk.json2022-11-22 22:20 836  
[   ]com.knirirr.beecount_125.apk.json2022-11-22 21:57 836  
[   ]com.picross.nonocross_10.apk.json2022-11-22 07:18 836  
[   ]com.serwylo.lexica_20010.apk.json2022-11-22 01:25 836  
[   ]com.utazukin.ichaival_21.apk.json2022-11-21 18:07 836  
[   ]com.utazukin.ichaival_22.apk.json2022-11-21 18:07 836  
[   ]com.utazukin.ichaival_31.apk.json2022-11-21 18:07 836  
[   ]