Builds that failed to reproduce

This is a list of apps whose most recent release failed to build reproducibly to the APKv1 signature.

Verified 66.3% of packages (1 ignored)

package namenamediffJSONversioncodedate
An.stop Anstop diffoscope JSON 1.5 10 2021-03-15
diffoscope JSON 1.5 10 2018-10-17
ac.robinson.mediaphone Com-Phone Story Maker diffoscope JSON 1.8.0 63 2025-06-20
diffoscope JSON 1.7.9 62 2025-06-13
diffoscope JSON 1.7.8 61 2025-05-27
diffoscope JSON 1.7.7 60 2025-04-11
diffoscope JSON 1.7.6 59 2024-12-02
diffoscope JSON 1.6.9 51 2022-08-12
diffoscope JSON 1.6.8 50 2024-06-07
diffoscope JSON 1.6.6 48 2021-05-31
diffoscope JSON 1.6.5 47 2021-03-15
diffoscope JSON 1.6.5 47 2021-03-09
ai.susi SUSI.AI diffoscope JSON 1.1.0 16 2021-03-15
diffoscope JSON 1.1.0 16 2019-12-22
akk.astro.droid.moonphase Moon Phase diffoscope JSON 1.2 2 2021-03-15
alt.nainapps.sharepaste.fdroid Share Paste O2 diffoscope JSON 2024.12.20 1734722268 2025-03-08
diffoscope JSON 2024.12.20 1734722267 2025-03-06
diffoscope JSON 2024.11.16 1731762268 2025-05-07
diffoscope JSON 2024.11.16 1731762267 2025-05-03
amirz.rootless.nexuslauncher Rootless Pixel Launcher diffoscope JSON 3.9.1 30911 2021-03-15
diffoscope JSON 3.9.1 30911 2019-09-12
anonvpn.anon_next.android ANONguard diffoscope JSON 00.00.022 22 2024-01-19
app.alextran.immich Immich diffoscope JSON 1.101.0 131 2024-04-05
diffoscope JSON 1.100.0 130 2024-03-31
diffoscope JSON 1.99.0 129 2024-03-23
diffoscope JSON 1.98.2 128 2024-03-18
diffoscope JSON 1.98.1 127 2024-03-10
diffoscope JSON 1.95.1 123 2024-02-25
diffoscope JSON 1.94.1 120 2024-02-19
app.comaps.fdroid CoMaps - Hike, Bike, Drive Offline with Privacy diffoscope JSON 2025.06.30-22-FDroid 25063022 2025-07-20
diffoscope JSON 2025.06.22-5-FDroid 25062205 2025-07-17
diffoscope JSON 2025.06.10-4-FDroid 25061004 2025-07-19
app.eduroam.geteduroam geteduroam diffoscope JSON 2.1.7(2675) 2675 2025-07-15
diffoscope JSON 2.1.7(2672) 2672 2025-05-19
diffoscope JSON 2.1.6(2671) 2671 2025-05-15
diffoscope JSON 2.1.6(2670) 2670 2025-05-12
diffoscope JSON 2.1.3(2666) 2666 2025-04-19
diffoscope JSON 2.1.2(2662) 2662 2025-03-18
app.fedilab.nitterizeme UntrackMe diffoscope JSON 1.30.0 33 2022-08-11
diffoscope JSON 1.18.0 30 2021-03-15
diffoscope JSON 1.9.1 17 2021-03-15
diffoscope JSON 1.9.1 17 2020-05-21
app.govroam.getgovroam getgovroam diffoscope JSON 2.1.7(2675) 2675 2025-07-15
diffoscope JSON 2.1.7(2672) 2672 2025-05-19
diffoscope JSON 2.1.6(2671) 2671 2025-05-15
diffoscope JSON 2.1.6(2670) 2670 2025-05-12
app.intra Intra diffoscope JSON 1.4.1 72 2025-05-15
diffoscope JSON 1.3.10 68 2024-03-10
diffoscope JSON 1.3.9 67 2024-02-15
diffoscope JSON 1.3.7 64 2022-08-13
app.organicmaps Organic Maps: Hike, Bike, Drive Offline diffoscope JSON 2024.11.12-7-FDroid 24111207 2024-12-07
diffoscope JSON 2024.10.23-2-FDroid 24102302 2024-12-09
app.passwordstore.agrahn Password Store diffoscope JSON 1.14.5 11405 2025-06-05
diffoscope JSON 1.14.4 11404 2025-05-30
app.pomodorot Pomodorot diffoscope JSON 0.11.0 153 2025-06-22
diffoscope JSON 0.11.0 152 2025-06-21
diffoscope JSON 0.11.0 151 2025-06-20
diffoscope JSON 0.10.3 143 2025-06-09
diffoscope JSON 0.10.3 142 2025-06-08
diffoscope JSON 0.10.3 141 2025-06-07
diffoscope JSON 0.10.2 133 2025-06-06
diffoscope JSON 0.10.2 132 2025-06-05
diffoscope JSON 0.10.2 131 2025-06-05
diffoscope JSON 0.10.1 123 2025-06-01
diffoscope JSON 0.10.1 122 2025-05-31
diffoscope JSON 0.10.1 121 2025-05-30
diffoscope JSON 0.9.0 103 2025-04-17
diffoscope JSON 0.9.0 102 2025-04-16
diffoscope JSON 0.9.0 101 2025-04-15
diffoscope JSON 0.8.1 93 2025-03-23
diffoscope JSON 0.8.1 92 2025-03-22
diffoscope JSON 0.8.1 91 2025-03-21
diffoscope JSON 0.8.0 83 2025-03-20
diffoscope JSON 0.8.0 82 2025-03-19
diffoscope JSON 0.8.0 81 2025-03-18
app.simple.peri Peristyle diffoscope JSON v9.0.0 900 2025-07-26
diffoscope JSON v7.0.4 704 2025-02-21
app.smarzaro.foss4g2024.schedule FOSS4G 2024 Schedule diffoscope JSON 1.67.0-FOSS4G2024-Edition 105 2024-12-01
app.tice.TICE.production TICE – Secure GPS Location Sharing with Friends diffoscope JSON 2.3 38 2022-11-09
app.udderance Udderance AAC diffoscope JSON 202506270 202506270 2025-07-16
app.wispar.wispar Wispar: Research Butler diffoscope JSON 0.5.0 24 2025-06-20
diffoscope JSON 0.3.2 20 2025-05-08
diffoscope JSON 0.3.0 15 2025-04-11
aq.com.sharetobrowser ShareToBrowser diffoscope JSON 1.0 1 2021-03-15
ardash.doodledudette Doodle Dudette diffoscope JSON 1.0.8 1000008 2024-12-01
diffoscope JSON 1.0.4 1000004 2024-06-12
ardash.lato Lato diffoscope JSON 1.1.4 1001004 2024-06-12
at.bitfire.cadroid CAdroid diffoscope JSON 1.0.3 8 2021-03-15
diffoscope JSON 1.0.3 8 2018-10-17
at.bitfire.davdroid DAVx⁵ diffoscope JSON 4.5.1-ose 405010003 2025-07-17
diffoscope JSON 4.5-ose 405000000 2025-07-17
diffoscope JSON 4.4.11-ose 404110004 2025-06-09
diffoscope JSON 4.4.10-ose 404100004 2025-05-15
diffoscope JSON 4.3.16.1-ose 403160100 2024-06-12
diffoscope JSON 4.3.14-ose 403140002 2024-03-06
diffoscope JSON 4.3.13.1-ose 403130100 2024-02-24
diffoscope JSON 4.3.13-ose 403130003 2024-02-18
diffoscope JSON 4.3.12.1-ose 403120101 2023-12-29
diffoscope JSON 4.3.11-ose 403110004 2023-11-24
diffoscope JSON 4.3.8-ose 403080000 2023-10-13
diffoscope JSON 4.3.7-ose 403070001 2023-10-04
diffoscope JSON 4.3.6.1-ose 403060100 2023-09-11
diffoscope JSON 4.3.5.2-ose 403050200 2023-09-01
diffoscope JSON 4.3.1-ose 403010002 2023-03-16
diffoscope JSON 4.3-ose 403000005 2023-02-15
diffoscope JSON 4.2.6-ose 402060000 2022-12-13
diffoscope JSON 4.2.4-ose 402040002 2022-11-04
diffoscope JSON 4.2.2-ose 402020000 2022-08-12
diffoscope JSON 3.3.9-ose 303090004 2021-03-15
diffoscope JSON 3.3.9-ose 303090004 2021-03-06
diffoscope JSON 3.1-ose 301000012 2021-03-15
diffoscope JSON 2.6.3.1-ose 329 2021-03-15
diffoscope JSON 2.6.3.1-ose 329 2020-01-24
diffoscope JSON 2.6.1.1-ose 315 2021-03-15
diffoscope JSON 2.6.1.1-ose 315 2019-12-20
diffoscope JSON 2.0.6-ose 251 2021-03-15
diffoscope JSON 2.0.6-ose 251 2018-12-07
diffoscope JSON 1.9-ose 182 2021-03-15
diffoscope JSON 1.9-ose 182 2018-10-17
diffoscope JSON 1.8.1-ose 172 2021-03-15
diffoscope JSON 1.8.1-ose 172 2018-10-17
diffoscope JSON 1.4.0.3-ose 138 2021-03-15
diffoscope JSON 1.4.0.3-ose 138 2018-10-17
at.krixec.ied IED diffoscope JSON Ad Nauseam +2 18 2025-06-09
diffoscope JSON Ad Nauseam +1 17 2025-06-05
diffoscope JSON Your Way +2 15 2025-03-01
diffoscope JSON Your Way +1 14 2025-02-27
diffoscope JSON Ni havas lingvojn 12 2025-03-09
at.tomtasche.reader LibreOffice & OpenOffice document reader | ODF diffoscope JSON 3.32 186 2024-12-02
diffoscope JSON 3.19 172 2022-08-15
atm.nasaimages NASA Images diffoscope JSON 1.1.1 3 2021-03-15
diffoscope JSON 1.1.1 3 2018-10-17
au.id.micolous.farebot Metrodroid diffoscope JSON 2.9.37 2005 2021-03-15
diffoscope JSON 2.9.37 2005 2020-01-25
diffoscope JSON v2.9.31-fdroid 31 2021-03-15
diffoscope JSON v2.9.31-fdroid 31 2018-10-17
diffoscope JSON v2.9.30-fdroid 30 2021-03-15
diffoscope JSON v2.9.30-fdroid 30 2018-10-17
axp.tool.apkextractor Apk Extractor diffoscope JSON 1.1 2 2021-03-15
be.brunoparmentier.dnssetter DNSSetter diffoscope JSON 0.1.2 3 2021-03-15
diffoscope JSON 0.1.2 3 2018-10-17
be.humanoids.webthingify Webthingify diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2019-12-22
be.ugent.zeus.hydra.open Hydra diffoscope JSON 3.7.4-open 37400 2025-01-20
diffoscope JSON 3.5.0-open 35000 2022-12-16
diffoscope JSON 3.4.0-open 34000 2022-11-06
be.uhasselt.privacypolice Wi-Fi Privacy Police diffoscope JSON 2.2.4 13 2021-03-15
diffoscope JSON 2.2.4 13 2018-10-17
br.com.frs.foodrestrictions Food Restrictions diffoscope JSON 1.0 2 2021-03-15
br.odb.knights The Knights of Alentejo diffoscope JSON 2.1 5 2021-03-15
diffoscope JSON 2.1 5 2018-10-17
btools.routingapp BRouter diffoscope JSON 1.7.8 55 2025-07-26
diffoscope JSON 1.7.4 51 2024-04-12
diffoscope JSON 1.7.3 50 2023-08-31
diffoscope JSON 1.7.2 49 2024-06-12
diffoscope JSON 1.7.0 47 2023-05-08
diffoscope JSON 1.6.3 43 2022-08-15
buet.rafi.dictionary Ridmik Dictionary diffoscope JSON 2.3 5 2021-03-15
diffoscope JSON 2.3 5 2018-10-17
bus.chio.wishmaster Overchan (fork) diffoscope JSON 1.0.1 1001 2021-03-15
diffoscope JSON 1.0.1 1001 2018-10-17
diffoscope JSON 1.0.0 1000 2021-03-15
diffoscope JSON 1.0.0 1000 2018-10-17
byrne.utilities.converter Bodha Converter diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
ca.farrelltonsolar.classic MidniteSolar Classic Monitor diffoscope JSON 2.5.0 250 2021-03-15
ca.fuwafuwa.kaku Kaku diffoscope JSON 1.3.78 78 2022-08-13
ca.mimic.apphangar Hangar diffoscope JSON 2.7 75 2021-03-15
diffoscope JSON 2.7 75 2018-10-17
ca.mudar.fairphone.peaceofmind Peace of Mind+ diffoscope JSON 2.1.4 22 2021-03-15
diffoscope JSON 2.1.4 22 2019-12-21
ca.ramzan.virtuosity Virtuosity diffoscope JSON 1.0.0 1 2021-05-30
ca.rmen.android.frenchcalendar French Calendar diffoscope JSON 1.18.0 1180 2021-03-15
diffoscope JSON 1.17.4 1174 2021-03-15
diffoscope JSON 1.15.2 1152 2021-03-15
ca.rmen.android.scrumchatter Scrum Chatter diffoscope JSON 1.6.3 10603 2021-03-15
diffoscope JSON 1.6.2 10602 2021-03-15
ca.rmen.nounours Nounours and friends diffoscope JSON 3.5.0 350 2021-04-05
diffoscope JSON 3.4.8 348 2021-03-15
diffoscope JSON 3.4.8 348 2019-12-23
diffoscope JSON 3.4.5 345 2021-03-15
ca.snoe.deedum deedum diffoscope JSON 2022.0406.0502 21 2022-08-14
diffoscope JSON 2020.1230.2319 13 2021-03-15
diffoscope JSON 2020.1230.2319 13 2021-03-08
cat.pantsu.nyaapantsu NyaaPantsu diffoscope JSON 1.0 1 2021-03-15
cc.kafuu.bilidownload BVD diffoscope JSON 2.2.1.foss 20201 2025-04-19
diffoscope JSON 2.1.5.foss 20105 2025-02-27
cc.narumi.chaldea.fdroid Chaldea diffoscope JSON 2.5.20 982 2025-07-16
diffoscope JSON 2.5.19 981 2025-06-09
ch.abertschi.adfree Ad-Free diffoscope JSON 3.2 42 2024-02-20
ch.fixme.cowsay Cowsay diffoscope JSON 1.4 5 2021-03-15
diffoscope JSON 1.4 5 2018-10-17
ch.ihdg.calendarcolor Calendar Color diffoscope JSON 0.4 4 2021-03-15
diffoscope JSON 0.4 4 2018-10-17
ch.thgoebel.spartathlonapp Spartathlon diffoscope JSON 0.8.2 11 2021-03-15
diffoscope JSON 0.8.2 11 2019-12-21
chat.fluffy.fluffychat FluffyChat diffoscope JSON 1.27.0 3540 2025-07-18
click.dummer.yidkey YidKey KD diffoscope JSON 1.1 11 2021-03-15
diffoscope JSON 1.1 11 2019-04-06
co.epitre.aelf_lectures AELF - Bible and day's reading diffoscope JSON 2.0.2 52 2021-03-15
diffoscope JSON 2.0.2 52 2019-12-22
com.GTP.eveminer EVE Mining Calc diffoscope JSON 1.3 19 2021-03-15
diffoscope JSON 1.3 19 2019-12-23
com.LAPARCELA.nihonoari Nihonoari: Hiragana & Katakana diffoscope JSON 1.7.2 12 2024-02-22
diffoscope JSON 1.5.0 7 2021-03-15
diffoscope JSON 1.5.0 7 2021-03-11
diffoscope JSON 1.2.1 4 2021-03-15
diffoscope JSON 1.2.1 4 2020-05-22
com.MNPDigital.holidayz Holidayz diffoscope JSON 1.0.3 4 2025-04-15
com.aa.mynotes My Notes - Take notes anywhere diffoscope JSON 1.5.1 7 2021-03-15
diffoscope JSON 1.5.1 7 2019-12-21
com.abast.homebot HomeBot diffoscope JSON 1.2 12 2021-03-15
diffoscope JSON 1.2 12 2019-12-21
com.acszo.redomi.repo Redomi diffoscope JSON 1.3.5 10305 2025-03-18
com.activitymanager Activity Manager diffoscope JSON 5.4.13 553 2025-02-21
com.adeeteya.classipod ClassiPod diffoscope JSON 1.11.0 24 2025-07-18
diffoscope JSON 1.8.0 18 2025-04-19
com.afollestad.nocknock Nock Nock diffoscope JSON 0.8.1 30 2021-03-15
diffoscope JSON 0.8.1 30 2019-12-22
diffoscope JSON 0.1.3.0 13 2021-03-15
com.aisleron Aisleron Shopping List diffoscope JSON 2025.5.0 7 2025-07-16
com.aj.wa.contact.adder WA Adder diffoscope JSON 1.0.1 2 2025-03-19
diffoscope JSON 1.0.0 1 2025-03-05
com.alaskalinuxuser.hourglass Hourglass diffoscope JSON 1.4 4 2021-03-15
diffoscope JSON 1.4 4 2018-10-17
com.alaskalinuxuser.justchess JustChess diffoscope JSON 2.5 13 2023-10-18
com.alaskalinuxuser.shipcaptainandcrew Ship Captain and Crew diffoscope JSON 1.6 6 2021-03-15
diffoscope JSON 1.6 6 2018-10-17
com.alexcruz.papuhwalls Papuh diffoscope JSON 2.0.6 10 2021-03-15
diffoscope JSON 2.0.6 10 2018-10-17
com.alexkang.bluechat BlueChat diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.alovoa.expo Alovoa diffoscope JSON 1.10.0 31 2024-04-11
diffoscope JSON 1.10.0 28 2024-04-05
diffoscope JSON 1.9.2 27 2024-03-28
diffoscope JSON 1.9.1 26 2024-03-23
diffoscope JSON 1.9.0 24 2024-03-12
com.amanoteam.kahon Kahon diffoscope JSON 0.18.1 12 2025-05-30
diffoscope JSON 0.17.2 10 2025-05-12
com.amaze.fileutilities Amaze File Utilities diffoscope JSON 1.92 132 2024-01-05
diffoscope JSON 1.91 128 2023-11-26
diffoscope JSON 1.90 121 2024-06-13
diffoscope JSON 1.89 120 2023-09-10
diffoscope JSON 1.85 104 2023-05-15
diffoscope JSON 1.83 96 2023-05-02
com.amnesica.kryptey KryptEY diffoscope JSON 0.1.5 24 2024-06-13
com.ancantus.HYPNOTOAD Hypnotoad Live Wallpaper diffoscope JSON 1.3 4 2021-03-15
diffoscope JSON 1.3 4 2018-10-17
com.android.talkback TalkBack diffoscope JSON TfPu_release_15_1-2024_10_17_0000 370044211 2024-12-02
com.androidfromfrankfurt.workingtimealert Working Time Alert diffoscope JSON 1.2 4 2021-03-15
diffoscope JSON 1.2 4 2019-12-22
com.angryburg.uapp la/u/ncher diffoscope JSON 4.2.5 425 2021-03-15
diffoscope JSON 4.2.5 425 2019-07-11
com.anoopknr.pastebin PasteBin diffoscope JSON 1.6 3 2021-03-15
diffoscope JSON 1.6 3 2021-03-10
diffoscope JSON 1.5 2 2021-03-15
diffoscope JSON 1.5 2 2019-07-11
com.anysoftkeyboard.languagepack.SSH AnySoftKeyboard: SSH diffoscope JSON 0.4.20120611-beta 4 2021-03-15
diffoscope JSON 0.4.20120611-beta 4 2018-10-17
com.anysoftkeyboard.languagepack.icelandic Icelandic for AnySoftKeyboard diffoscope JSON 2.0.0 52 2021-03-15
com.anysoftkeyboard.languagepack.malayalam AnySoftKeyboard: Malayalam diffoscope JSON 20130916-4 2 2021-03-15
diffoscope JSON 20130916-4 2 2018-10-17
com.anysoftkeyboard.languagepack.neo AnySoftKeyboard: NEO2 diffoscope JSON 2.0 8 2021-03-15
diffoscope JSON 1.6 7 2021-03-15
com.anysoftkeyboard.languagepack.portuguese Portuguese for AnySoftKeyboard diffoscope JSON 2.0.1 101 2021-03-15
diffoscope JSON 2.0 100 2021-03-15
com.anysoftkeyboard.languagepack.slovene Slovene for AnySoftKeyboard diffoscope JSON 2.0 100 2021-03-15
com.anysoftkeyboard.languagepack.swedish Swedish for AnySoftKeyboard diffoscope JSON 2.0.3 103 2021-03-15
com.anysoftkeyboard.languagepack.ukrainian Ukrainian for AnySoftKeyboard diffoscope JSON 2.0 100 2021-03-15
com.app.Zensuren Zensuren diffoscope JSON 1.21 121 2021-03-15
com.app.equran eQuran diffoscope JSON 1.4.0 123 2024-05-17
com.app.missednotificationsreminder Missed Notifications Reminder diffoscope JSON 1.6.5.2.22 2010605222 2022-01-11
diffoscope JSON 1.3.2.0.21 2010302021 2019-12-21
diffoscope JSON 1.1.11 1801011100 2021-03-15
diffoscope JSON 1.1.11 1801011100 2018-10-17
com.aptasystems.dicewarepasswordgenerator Diceware Password Generator diffoscope JSON 1.8 9 2021-03-15
diffoscope JSON 1.8 9 2019-01-16
com.aragaer.jtt Japanese Traditional Time diffoscope JSON 1.6 34 2021-03-15
com.artifex.mupdf.mini.app MuPDF mini diffoscope JSON 1.26.3a 163 2025-07-16
diffoscope JSON 1.26.2a 162 2025-06-13
diffoscope JSON 1.26.1a 161 2025-05-27
diffoscope JSON 1.26.0a 160 2025-05-19
diffoscope JSON 1.25.6a 156 2025-04-10
diffoscope JSON 1.25.5a 155 2025-03-22
diffoscope JSON 1.25.4a 154 2025-02-01
diffoscope JSON 1.25.3a 153 2025-02-01
diffoscope JSON 1.25.1a 151 2024-12-07
diffoscope JSON 1.25.0a 150 2024-12-05
diffoscope JSON 1.24.11a 146 2024-12-06
com.artifex.mupdf.viewer.app MuPDF viewer diffoscope JSON 1.26.3a 173 2025-07-16
diffoscope JSON 1.26.2a 172 2025-06-13
diffoscope JSON 1.26.1a 171 2025-05-28
diffoscope JSON 1.26.0a 170 2025-05-19
diffoscope JSON 1.25.6a 166 2025-04-10
diffoscope JSON 1.25.5a 165 2025-03-22
diffoscope JSON 1.25.4a 164 2025-02-23
diffoscope JSON 1.25.3a 163 2025-02-01
diffoscope JSON 1.25.1a 161 2024-12-07
diffoscope JSON 1.25.0a 160 2024-12-05
diffoscope JSON 1.24.11a 156 2024-12-06
com.arxlibertatis Arx Libertatis diffoscope JSON 1.3.5.3 11 2025-02-22
diffoscope JSON 1.3.5.2 10 2025-03-02
diffoscope JSON 1.3.5 8 2025-04-23
diffoscope JSON 1.3.4.1 7 2024-12-10
diffoscope JSON 1.3.4 6 2024-12-06
diffoscope JSON 1.3.3.1 5 2024-12-10
diffoscope JSON 1.3.2 3 2024-12-09
com.asdoi.gymwen GymWen diffoscope JSON 1.4.4 144 2023-01-03
diffoscope JSON 1.4.2 142 2024-06-13
com.ath0.rpn RPN diffoscope JSON 2.0.3 17 2021-03-15
diffoscope JSON 2.0.3 17 2018-10-17
com.atharok.barcodescanner Barcode Scanner diffoscope JSON 1.25.3 48 2025-07-17
com.b44t.messenger Delta Chat diffoscope JSON 1.58.4 7224 2025-05-26
diffoscope JSON 1.58.4 7223 2025-05-25
diffoscope JSON 1.58.4 7222 2025-05-24
diffoscope JSON 1.58.4 7221 2025-05-23
diffoscope JSON 1.58.3 7214 2025-05-18
diffoscope JSON 1.58.3 7213 2025-05-17
diffoscope JSON 1.58.3 7212 2025-05-16
diffoscope JSON 1.58.3 7211 2025-05-15
diffoscope JSON 1.58.2 7204 2025-05-08
diffoscope JSON 1.58.2 7203 2025-05-06
diffoscope JSON 1.58.2 7202 2025-05-05
diffoscope JSON 1.58.2 7201 2025-05-04
diffoscope JSON 1.58.1 7194 2025-05-03
diffoscope JSON 1.58.1 7193 2025-05-02
diffoscope JSON 1.58.1 7192 2025-05-01
diffoscope JSON 1.58.1 7191 2025-04-30
diffoscope JSON 1.58.0 7184 2025-04-27
diffoscope JSON 1.58.0 7183 2025-04-26
diffoscope JSON 1.58.0 7182 2025-04-25
diffoscope JSON 1.58.0 7181 2025-04-24
diffoscope JSON 1.56.1 7174 2025-04-16
diffoscope JSON 1.56.1 7173 2025-04-15
diffoscope JSON 1.56.1 7172 2025-04-11
diffoscope JSON 1.56.1 7171 2025-04-10
diffoscope JSON 1.56.0 7164 2025-03-27
diffoscope JSON 1.56.0 7163 2025-03-26
diffoscope JSON 1.56.0 7162 2025-03-25
diffoscope JSON 1.56.0 7161 2025-03-24
diffoscope JSON 1.54.4 7154 2025-03-23
diffoscope JSON 1.54.4 7153 2025-03-22
diffoscope JSON 1.54.4 7152 2025-03-21
diffoscope JSON 1.54.4 7151 2025-03-20
diffoscope JSON 1.54.3 7144 2025-03-19
diffoscope JSON 1.54.3 7143 2025-03-18
diffoscope JSON 1.54.3 7142 2025-03-17
diffoscope JSON 1.54.3 7141 2025-03-16
diffoscope JSON 1.54.2 7134 2025-03-15
diffoscope JSON 1.54.2 7133 2025-03-14
diffoscope JSON 1.54.2 7132 2025-03-13
diffoscope JSON 1.54.2 7131 2025-03-12
diffoscope JSON 1.54.0 7114 2025-03-11
diffoscope JSON 1.54.0 7113 2025-03-09
diffoscope JSON 1.54.0 7112 2025-03-08
diffoscope JSON 1.54.0 7111 2025-03-07
diffoscope JSON 1.52.1 7104 2025-03-06
diffoscope JSON 1.52.1 7103 2025-03-05
diffoscope JSON 1.52.1 7102 2025-03-03
diffoscope JSON 1.52.1 7101 2025-03-02
diffoscope JSON 1.52.0 7094 2025-03-01
diffoscope JSON 1.52.0 7093 2025-02-28
diffoscope JSON 1.52.0 7092 2025-02-26
diffoscope JSON 1.52.0 7091 2025-02-23
diffoscope JSON 1.44.0 6804 2024-03-12
diffoscope JSON 1.42.6 6774 2023-12-18
diffoscope JSON 1.42.4 6754 2023-11-30
diffoscope JSON 1.36.2 6514 2023-04-09
diffoscope JSON 1.36.0 6504 2023-03-31
diffoscope JSON 1.34.13 6494 2023-02-23
diffoscope JSON 1.34.10 6464 2023-01-12
diffoscope JSON 1.34.8 6444 2022-12-26
diffoscope JSON 1.34.5 6424 2022-12-15
diffoscope JSON 1.34.3 640 2022-11-05
diffoscope JSON 1.22.1 613 2022-08-13
diffoscope JSON 1.20.2 607 2021-05-30
diffoscope JSON 1.14.5 600 2021-03-15
diffoscope JSON 1.14.5 600 2021-03-10
diffoscope JSON 1.8.1 582 2021-03-15
diffoscope JSON 1.8.1 582 2020-05-21
diffoscope JSON 0.510.1 550 2021-03-15
diffoscope JSON 0.510.1 550 2019-12-22
diffoscope JSON 0.500.0 548 2021-03-15
diffoscope JSON 0.500.0 548 2019-07-05
diffoscope JSON 0.200.0 540 2021-03-15
diffoscope JSON 0.200.0 540 2019-04-06
diffoscope JSON 0.9.6 453 2021-03-15
diffoscope JSON 0.9.6 453 2018-10-17
diffoscope JSON 0.1.36 363 2021-03-15
diffoscope JSON 0.1.36 363 2018-10-17
com.bec3.mobilite DioLite diffoscope JSON 1.3.10 10310 2021-03-15
diffoscope JSON 1.3.10 10310 2018-10-17
com.bernaferrari.changedetection Change Detection diffoscope JSON 2.2 32 2021-03-15
diffoscope JSON 2.2 32 2020-06-11
diffoscope JSON 2.1 30 2021-03-15
diffoscope JSON 2.1 30 2019-12-23
com.bernaferrari.sdkmonitor SDK Monitor diffoscope JSON 2.0.1 15 2025-06-20
diffoscope JSON 0.98 12 2021-03-15
diffoscope JSON 0.98 12 2021-03-11
diffoscope JSON 0.3 3 2021-03-15
com.bibleside.bibleside Bibleside diffoscope JSON 0.3.1-alpha 11 2025-01-18
diffoscope JSON 0.3.0-alpha 10 2025-01-21
com.biglybt.android.client BiglyBT, Torrent Downloader diffoscope JSON 1.3.4.3 1030403 2024-02-21
diffoscope JSON 1.2.4 1020400 2021-03-15
diffoscope JSON 1.2.4 1020400 2019-12-23
diffoscope JSON 1.2.2 37 2021-03-15
diffoscope JSON 1.2.2 37 2019-01-16
diffoscope JSON 1.2.1 35 2021-03-15
diffoscope JSON 1.2.1 35 2018-12-06
com.blanyal.remindly Remindly diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2018-10-17
com.blazecode.tsviewer TSViewer diffoscope JSON 2.1.0-foss 11 2023-11-26
diffoscope JSON 2.0.2-foss 10 2023-09-04
diffoscope JSON 2.0-foss 8 2024-06-07
diffoscope JSON 1.3 6 2022-11-07
com.blogspot.e_kanivets.moneytracker Money Tracker diffoscope JSON 2.2.0 38 2023-03-17
diffoscope JSON 2.1.5 37 2022-08-15
com.boardgamegeek BoardGameGeek diffoscope JSON 4.8.4 41 2021-03-15
diffoscope JSON 4.8.4 41 2018-10-17
com.bobek.compass Compass diffoscope JSON 1.14.9 29 2025-05-12
diffoscope JSON 1.14.8 28 2025-03-10
diffoscope JSON 1.14.6 26 2025-05-02
diffoscope JSON 1.14.5 25 2024-12-09
diffoscope JSON 1.14.4 24 2024-12-14
diffoscope JSON 1.14.0 20 2024-06-13
com.bobek.metronome Metronome diffoscope JSON 1.7.1 19 2025-05-19
diffoscope JSON 1.7.0 18 2025-05-12
diffoscope JSON 1.6.5 17 2025-03-10
diffoscope JSON 1.6.3 15 2025-04-29
diffoscope JSON 1.6.2 14 2024-12-09
diffoscope JSON 1.5.0 11 2024-06-13
com.boldwallet Bold Bitcoin Wallet diffoscope JSON 1.3.0 4 2025-07-17
diffoscope JSON 1.2.0 3 2025-07-15
diffoscope JSON 1.1.0 2 2025-06-20
diffoscope JSON 1.0 1 2025-05-19
com.brapeba.roaminginfo Roaming Info diffoscope JSON 4.19 44 2021-03-15
diffoscope JSON 4.19 44 2018-10-17
com.brentpanther.bitcoinwidget Simple Crypto Widget diffoscope JSON 8.7.2 343 2025-07-16
diffoscope JSON 8.7.1 342 2025-06-16
diffoscope JSON 6.7 197 2021-03-15
diffoscope JSON 6.7 197 2019-01-16
diffoscope JSON 5.2.2 122 2021-03-15
diffoscope JSON 5.0.5 106 2021-03-15
com.brentpanther.ethereumwidget Simple Ethereum Widget diffoscope JSON 1.2.2 22 2021-03-15
com.brentpanther.litecoinwidget Simple Litecoin Widget diffoscope JSON 1.1.2 12 2021-03-15
com.brillenheini.deepscratch.free Deep Scratch diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
com.bringyour.network URnetwork diffoscope JSON 2025.6.30 665515983 2025-07-19
diffoscope JSON 2025.6.30 665515982 2025-07-18
diffoscope JSON 2025.6.29 663875403 2025-07-17
diffoscope JSON 2025.6.29 663875402 2025-07-16
diffoscope JSON 2025.6.19 655941463 2025-06-27
diffoscope JSON 2025.6.19 655941462 2025-06-26
com.buzbuz.smartautoclicker Klick'r - Smart AutoClicker diffoscope JSON 3.3.9 77 2025-07-26
diffoscope JSON 3.3.7 75 2025-07-16
diffoscope JSON 3.3.5 73 2025-06-26
diffoscope JSON 3.3.4 72 2025-06-16
diffoscope JSON 3.3.3 71 2025-05-23
diffoscope JSON 3.3.2 70 2025-05-08
diffoscope JSON 3.3.1 69 2025-05-04
diffoscope JSON 3.3.0 68 2025-04-30
diffoscope JSON 3.2.2 61 2025-02-26
diffoscope JSON 3.2.1 60 2025-01-20
diffoscope JSON 3.2.0 59 2025-01-18
diffoscope JSON 3.0.6 53 2024-12-08
diffoscope JSON 3.0.5 52 2024-12-14
diffoscope JSON 3.0.4 51 2024-12-10
diffoscope JSON 2.4.2 41 2024-01-30
diffoscope JSON 2.4.1 40 2023-12-05
diffoscope JSON 2.4.0 39 2023-11-24
diffoscope JSON 2.3.1 33 2023-09-24
diffoscope JSON 2.2.0 31 2023-08-31
diffoscope JSON 2.1.0 26 2023-05-14
diffoscope JSON 2.0.2 23 2023-03-06
diffoscope JSON 2.0.1 22 2023-02-28
diffoscope JSON 2.0.0 21 2023-02-27
diffoscope JSON 1.5.4 20 2022-11-07
diffoscope JSON 1.5.1 17 2022-08-13
com.bwqr.mavinote Mavinote diffoscope JSON 0.2.0 200 2023-12-03
com.byagowi.persiancalendar Persian Calendar diffoscope JSON 9.8.5 985 2025-05-30
diffoscope JSON 6.2.2 622 2021-03-15
diffoscope JSON 6.2.2 622 2020-05-22
diffoscope JSON 5.9.4 594 2021-03-15
diffoscope JSON 5.9.4 594 2019-07-11
diffoscope JSON 5.3.1 531 2021-03-15
diffoscope JSON 5.2.2 522 2021-03-15
com.bytesforge.linkasanote LaaNo diffoscope JSON 0.3.4 30499 2021-03-15
diffoscope JSON 0.3.4 30499 2019-12-20
com.calcitem.sanmill Mill diffoscope JSON 5.6.0 4384 2024-12-11
diffoscope JSON 4.0.9 3929 2024-03-10
diffoscope JSON 4.0.8 3920 2024-02-24
diffoscope JSON 4.0.7 3918 2024-02-18
diffoscope JSON 2.0.17 3178 2022-12-14
diffoscope JSON 1.1.43 2225 2022-08-14
diffoscope JSON 1.0.14 1847 2021-05-28
com.carriez.flutter_hbb RustDesk diffoscope JSON 1.4.0 104000003 2025-05-16
diffoscope JSON 1.4.0 104000002 2025-05-15
diffoscope JSON 1.4.0 104000001 2025-05-19
diffoscope JSON 1.3.9 103090003 2025-04-15
diffoscope JSON 1.3.9 103090002 2025-04-11
diffoscope JSON 1.3.9 103090001 2025-04-10
diffoscope JSON 1.3.8 103080003 2025-03-05
diffoscope JSON 1.3.8 103080002 2025-03-03
diffoscope JSON 1.3.8 103080001 2025-02-28
diffoscope JSON 1.3.7 103070003 2025-02-02
diffoscope JSON 1.3.7 103070002 2025-02-01
diffoscope JSON 1.3.7 103070001 2025-02-03
diffoscope JSON 1.3.3 103030003 2024-12-07
diffoscope JSON 1.3.3 103030002 2024-12-06
diffoscope JSON 1.3.3 103030001 2024-12-05
diffoscope JSON 1.2.3-2 12308 2023-12-01
diffoscope JSON 1.1.10-1 28 2022-08-12
com.casimirlab.simpleDeadlines Simple Deadlines diffoscope JSON 3.2.3 19 2021-03-15
diffoscope JSON 3.2.3 19 2018-10-17
com.catalin.css_px_converter PX:VW - converter diffoscope JSON 1.0.0 1 2022-11-08
com.catalin.rivia Rivia diffoscope JSON 1.0.0 1 2022-11-08
com.cgogolin.library Library diffoscope JSON 5.1 31 2021-03-15
diffoscope JSON 4.4 27 2021-03-15
diffoscope JSON 4.2.1 24 2021-03-15
com.chesire.nekome Nekome diffoscope JSON 2.2.2 24012317 2024-01-26
diffoscope JSON 2.2.1 24012009 2024-01-22
diffoscope JSON 2.2.0 24010710 2024-01-09
diffoscope JSON 2.1.1 23101020 2023-11-27
diffoscope JSON 2.0.5 23071421 2023-09-02
com.chessclock.android Simple Chess Clock diffoscope JSON 2.11.3 30 2022-08-11
diffoscope JSON 2.9.0 25 2022-03-11
diffoscope JSON 2.7.0 23 2022-01-08
com.ciarang.tallyphant Tallyphant diffoscope JSON 0.4 5 2021-03-15
diffoscope JSON 0.4 5 2018-10-17
com.cleveroad.sample PlayMusic Widget (sample) diffoscope JSON 1.0 1 2021-03-15
com.cliffracertech.soundaura SoundAura diffoscope JSON 1.5.0 10 2024-03-17
diffoscope JSON 1.4.1 9 2023-02-16
diffoscope JSON 1.3.1 7 2022-12-16
diffoscope JSON 1.3.0 6 2022-11-06
com.coboltforge.dontmind.multivnc MultiVNC diffoscope JSON 2.1.8 101 2024-12-10
diffoscope JSON 2.1.7 100 2024-12-08
diffoscope JSON 2.1.6 99 2024-12-09
diffoscope JSON 2.1.4 97 2024-02-21
diffoscope JSON 2.0.9 91 2022-08-09
diffoscope JSON 1.9.11 79 2021-03-15
diffoscope JSON 1.9.11 79 2021-03-06
diffoscope JSON 1.8.10 65 2021-03-15
com.code61.deadpixel DeadPixel diffoscope JSON 1.0 2 2021-03-15
diffoscope JSON 1.0 2 2018-10-17
com.codelv.inventory Inventory diffoscope JSON 1.0.8 8 2025-03-18
com.color.colornamer Color Namer diffoscope JSON 2.32 10 2021-03-15
diffoscope JSON 2.32 10 2018-10-17
com.commit451.gitlab LabCoat diffoscope JSON 2.7.9 2070900 2024-05-11
diffoscope JSON 2.4.3 2040300 2021-03-15
com.concept1tech.instalate InstaLate diffoscope JSON 1.2.2 13 2022-08-16
com.cradle.iitc_mobile IITC Mobile diffoscope JSON 0.25.2 104 2021-03-15
diffoscope JSON 0.25.2 104 2018-10-17
com.crawlmb Dungeon Crawl: Stone Soup for Android diffoscope JSON 0.29.1b 38 2024-06-13
com.czy0729.bangumi Bangumi diffoscope JSON 7.7.0 70701 2024-02-26
com.daniebeler.pfpixelix Pixelix diffoscope JSON 4.1.1 32 2025-06-20
com.darkrockstudios.apps.hammer.android Hammer diffoscope JSON 1.10.2 110030000 2025-06-13
diffoscope JSON 1.10.0 110010000 2025-04-10
diffoscope JSON 1.9.2 109030000 2024-12-07
diffoscope JSON 1.9.0 109010000 2024-12-07
diffoscope JSON 1.8.1 108020000 2024-12-09
diffoscope JSON 1.6.0 27 2024-01-29
diffoscope JSON 1.5.4 26 2024-06-13
com.daviancorp.android.mh4udatabase MH4U Database diffoscope JSON 1.08 13 2021-03-15
diffoscope JSON 1.08 13 2018-10-17
com.derdilla.bloodPressureApp Blood pressure monitor diffoscope JSON 1.8.8 50 2025-07-17
diffoscope JSON 1.8.7 49 2025-07-19
com.dergoogler.mmrl MMRL diffoscope JSON v33920-release 33920 2025-07-17
diffoscope JSON v33913-release 33913 2025-07-16
diffoscope JSON v33890-release 33890 2025-07-15
diffoscope JSON v33858-release 33858 2025-06-26
diffoscope JSON v33813-release 33813 2025-06-23
diffoscope JSON v33780-release 33780 2025-06-16
diffoscope JSON v33773-release 33773 2025-06-13
diffoscope JSON v33751-release 33751 2025-06-09
diffoscope JSON v33653-release 33653 2025-05-30
diffoscope JSON v33633-release 33633 2025-05-23
diffoscope JSON v33624-release 33624 2025-05-15
diffoscope JSON v33599-release 33599 2025-05-12
diffoscope JSON v33424-release 33424 2025-04-19
diffoscope JSON 3.24.32 32432 2024-12-10
com.dfa.hubzilla_android Nomad - Hubzilla for Android diffoscope JSON 0.8.16 46 2021-03-15
diffoscope JSON 0.8.16 46 2019-12-21
diffoscope JSON 0.8.12 42 2021-03-15
diffoscope JSON 0.8.12 42 2018-12-06
com.dfzlv.gjjlt.caramelos Caramelos diffoscope JSON 1.6 7 2021-03-15
diffoscope JSON 1.6 7 2018-10-17
com.digitalfishfun.openshift OpenShift diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.dirkgassen.wator Wa-Tor diffoscope JSON 1.2 1002000 2021-03-15
diffoscope JSON 1.2 1002000 2018-10-17
com.dot.gallery Gallery diffoscope JSON 3.1.2 312094 2025-04-28
diffoscope JSON 3.1.2 312093 2025-04-25
diffoscope JSON 3.1.2 312091 2025-04-24
diffoscope JSON 3.1.1 311202 2025-02-23
com.doubleangels.nextdnsmanagement NextDNS Manager diffoscope JSON 5.5.14 263 2025-07-16
diffoscope JSON 5.5.13 262 2025-04-11
diffoscope JSON 5.5.12 261 2025-03-13
diffoscope JSON 5.5.11 260 2025-03-03
diffoscope JSON 5.5.8 257 2025-02-28
diffoscope JSON 5.5.7 256 2025-02-25
diffoscope JSON 5.4.9 243 2025-02-05
diffoscope JSON 5.4.3 237 2025-02-03
diffoscope JSON 5.4.1 235 2025-02-02
diffoscope JSON 5.4.0 234 2025-01-18
diffoscope JSON 5.3.0 233 2024-12-18
diffoscope JSON 4.11.3 208 2024-03-12
diffoscope JSON 4.11.1 206 2024-03-02
com.dozingcatsoftware.vectorcamera Vector Camera diffoscope JSON 1.7.0 14 2022-12-25
diffoscope JSON 1.5.0 12 2021-03-15
diffoscope JSON 1.5.0 12 2021-03-11
com.drip drip. menstrual cycle and fertility tracking diffoscope JSON 1.2403.19 33 2024-03-24
com.duckduckgo.mobile.android DuckDuckGo Privacy Browser diffoscope JSON 5.241.0 52410000 2025-07-22
diffoscope JSON 5.240.0 52400000 2025-07-18
diffoscope JSON 5.239.1 52391000 2025-07-17
diffoscope JSON 5.238.0 52380000 2025-07-17
diffoscope JSON 5.237.0 52370000 2025-06-23
diffoscope JSON 5.236.1 52361000 2025-06-16
diffoscope JSON 5.234.2 52342000 2025-06-10
diffoscope JSON 5.233.0 52330000 2025-06-09
diffoscope JSON 5.231.1 52311000 2025-06-05
diffoscope JSON 5.229.0 52290000 2025-05-01
diffoscope JSON 5.227.1 52271000 2025-03-21
diffoscope JSON 5.225.0 52250000 2025-02-26
diffoscope JSON 5.224.0 52240000 2025-02-25
diffoscope JSON 5.222.0 52220000 2025-01-18
diffoscope JSON 5.220.0 52200000 2024-12-10
diffoscope JSON 5.219.0 52190000 2024-12-07
diffoscope JSON 5.218.1 52181000 2024-12-07
diffoscope JSON 5.217.0 52170000 2024-12-03
diffoscope JSON 5.13.0 51300 2021-03-15
diffoscope JSON 5.13.0 51300 2018-12-06
diffoscope JSON 3.1.1 101 2021-03-15
diffoscope JSON 3.1.1 101 2018-10-17
diffoscope JSON 3.0.14 76 2021-03-15
diffoscope JSON 3.0.14 76 2018-10-17
com.easwareapps.baria BARIA diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.easwareapps.g2l G2L diffoscope JSON 2.2 23 2021-03-15
diffoscope JSON 2.2 23 2018-10-17
com.easwareapps.quoter Quoter diffoscope JSON 1.0.1 3 2021-03-15
diffoscope JSON 1.0.1 3 2018-10-17
com.easwareapps.transparentwidget Transparent Widget diffoscope JSON 1.0.1 2 2021-03-15
com.ei.bmicalc BmiCalc diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2021-03-09
com.elementlo.spark_list Shorey diffoscope JSON 0.2.0-beta 7 2022-11-09
com.elfeedcljsrn Elfeed Mobile diffoscope JSON 2.4.0 10 2024-02-21
com.emmanuelmess.simpleaccounting Simple Accounting diffoscope JSON 1.5.2 20 2021-03-15
diffoscope JSON 1.5.2 20 2018-12-06
com.emmanuelmess.simplecleanup Simple Cleanup diffoscope JSON 1.0.1 4 2021-03-15
diffoscope JSON 1.0.1 4 2019-12-22
com.eneko.hexcolortimewallpaper HexColorTime Wallpaper diffoscope JSON 1.1 2 2021-03-15
com.enjoyingfoss.feeel Feeel - home workouts diffoscope JSON 2.4.1 4241 2022-12-15
diffoscope JSON 1.94 6 2021-03-15
diffoscope JSON 1.94 6 2019-01-16
com.etesync.syncadapter EteSync - Secure Data Sync diffoscope JSON 2.4.4 20404 2024-03-04
diffoscope JSON 2.4.3 20403 2023-12-03
diffoscope JSON 2.4.2 20402 2024-06-08
diffoscope JSON 2.2.4 20204 2021-03-15
diffoscope JSON 2.2.4 20204 2021-03-08
diffoscope JSON 1.13.0 108 2021-03-15
diffoscope JSON 1.12.0 107 2021-03-15
diffoscope JSON 1.12.0 107 2020-05-22
diffoscope JSON 1.9.8 98 2021-03-15
diffoscope JSON 1.9.8 98 2020-01-24
diffoscope JSON 1.9.6 96 2021-03-15
diffoscope JSON 1.9.6 96 2019-12-20
diffoscope JSON 0.22.6 43 2021-03-15
diffoscope JSON 0.22.6 43 2019-01-16
diffoscope JSON 0.22.3 40 2021-03-15
diffoscope JSON 0.22.3 40 2018-12-06
diffoscope JSON 0.19.1 19 2021-03-15
diffoscope JSON 0.19.1 19 2018-10-17
diffoscope JSON 0.18.2 17 2021-03-15
diffoscope JSON 0.18.2 17 2018-10-17
diffoscope JSON 0.18.1 16 2021-03-15
diffoscope JSON 0.18.1 16 2018-10-17
diffoscope JSON 0.18.0 15 2021-03-15
diffoscope JSON 0.18.0 15 2018-10-17
diffoscope JSON 0.12.0 9 2021-03-15
diffoscope JSON 0.12.0 9 2018-10-17
diffoscope JSON 0.9.1 4 2021-03-15
diffoscope JSON 0.9.1 4 2018-10-17
com.evenement.encapsulation Eve-control diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.example.android.monthcalendarwidget Month Calendar Widget diffoscope JSON 0.1 1 2021-03-15
diffoscope JSON 0.1 1 2018-10-17
com.example.harisont.librery Librery diffoscope JSON 3.0 4 2021-03-15
diffoscope JSON 3.0 4 2019-04-06
com.example.hochi.nextcompanion NextCompanion diffoscope JSON 0.1.7.2 9 2022-01-10
diffoscope JSON 0.1.6 7 2021-03-15
diffoscope JSON 0.1.6 7 2019-12-22
diffoscope JSON 0.1.5 6 2021-03-15
diffoscope JSON 0.1.5 6 2019-04-06
com.example.openpass OpenPass diffoscope JSON 1.0 1 2021-03-15
com.example.root.analyticaltranslator Analytical Translator diffoscope JSON 0.06 6 2021-03-15
com.example.trigger Trigger diffoscope JSON 4.0.7 407 2025-04-30
diffoscope JSON 4.0.6 406 2025-02-25
diffoscope JSON 4.0.5 405 2025-02-21
diffoscope JSON 4.0.4 404 2025-02-03
diffoscope JSON 4.0.3 403 2025-02-02
diffoscope JSON 3.4.2 342 2022-03-10
diffoscope JSON 3.3.6 336 2022-01-09
diffoscope JSON 3.3.0 330 2021-05-31
diffoscope JSON 1.7.1 171 2021-03-15
diffoscope JSON 1.7.1 171 2019-04-06
com.exifthumbnailadder.app Exif Thumbnail Adder diffoscope JSON 1.0.1 767 2025-05-27
diffoscope JSON 0.9.19 679 2024-02-22
com.falconware.prestissimo Prestissimo diffoscope JSON 1.0 11 2021-03-15
diffoscope JSON 1.0 11 2018-10-17
com.farmerbb.notepad Notepad diffoscope JSON 3.0.6 122 2024-12-10
diffoscope JSON 3.0.5 121 2024-12-14
diffoscope JSON 3.0.4 119 2023-09-03
diffoscope JSON 2.3.7 112 2021-03-15
diffoscope JSON 2.3.7 112 2021-03-08
diffoscope JSON 2.3.6 111 2021-03-15
diffoscope JSON 2.3.5 110 2021-03-15
diffoscope JSON 2.3.5 110 2019-12-22
diffoscope JSON 2.3.4 109 2021-03-15
diffoscope JSON 2.3.4 109 2019-01-16
com.farmerbb.secondscreen.free SecondScreen diffoscope JSON 2.9.4 186 2024-12-10
diffoscope JSON 2.9.3 185 2023-02-17
diffoscope JSON 2.9.2 184 2021-03-15
diffoscope JSON 2.9.2 184 2021-03-08
diffoscope JSON 2.8.2 180 2021-03-15
diffoscope JSON 2.8.2 180 2018-12-07
com.farmerbb.taskbar Taskbar diffoscope JSON 6.2.2-r2 208 2024-12-06
diffoscope JSON 6.2.2 207 2024-12-10
diffoscope JSON 6.2.1 206 2024-12-10
diffoscope JSON 6.2 204 2022-08-16
diffoscope JSON 6.1.1 203 2021-03-15
diffoscope JSON 6.1.1 203 2021-03-09
diffoscope JSON 6.0 201 2021-03-15
diffoscope JSON 4.0.1 192 2021-03-15
diffoscope JSON 4.0.1 192 2018-12-07
diffoscope JSON 3.6 155 2021-03-15
diffoscope JSON 3.0.7 122 2021-03-15
com.feko.generictabletoprpg gttrpg diffoscope JSON 1.3.0 8 2025-05-12
com.flipperdevices.app Flipper Mobile App diffoscope JSON 1.8.1 1878 2025-07-16
diffoscope JSON 1.8.0 1828 2024-12-07
diffoscope JSON 1.6.7 1326 2024-06-08
com.florianthaler.githo Githo diffoscope JSON 1.3.4 12 2022-08-13
com.flxrs.dankchat DankChat diffoscope JSON 3.11.6 31106 2025-04-30
diffoscope JSON 3.11.5 31105 2025-04-19
diffoscope JSON 3.11.4 31104 2025-04-16
diffoscope JSON 3.10.6 31006 2025-04-16
diffoscope JSON 3.10.4 31004 2025-04-11
com.fmsys.snapdrop Snapdrop & PairDrop for Android diffoscope JSON 2.3.1 45 2025-02-21
diffoscope JSON 2.3.0 44 2024-12-07
diffoscope JSON 2.2.4 43 2023-11-27
diffoscope JSON 2.2.2 41 2023-06-06
diffoscope JSON 2.2.1 40 2023-05-24
diffoscope JSON 2.2.0 39 2023-05-15
diffoscope JSON 2.0.3 37 2023-04-12
diffoscope JSON 2.0.0 34 2023-03-25
diffoscope JSON 1.12.0 32 2023-02-14
com.foobnix.pro.pdf.reader Librera Reader diffoscope JSON 8.9.182-fdroid 6202 2025-05-03
diffoscope JSON 8.9.161-fdroid 6030 2024-03-18
diffoscope JSON 8.9.158-fdroid 6018 2024-01-08
diffoscope JSON 8.9.147-fdroid 5974 2024-01-05
diffoscope JSON 8.9.133-fdroid 5918 2023-12-24
diffoscope JSON 8.9.115-fdroid 5850 2023-12-17
diffoscope JSON 8.9.72-fdroid 5710 2023-12-01
diffoscope JSON 8.9.58-fdroid 5654 2023-11-25
diffoscope JSON 8.8.107-fdroid 5366 2023-04-15
diffoscope JSON 8.8.98-fdroid 5330 2023-04-12
diffoscope JSON 8.8.76-fdroid 5242 2023-03-24
diffoscope JSON 8.8.68-fdroid 5210 2023-03-18
diffoscope JSON 8.8.46-fdroid 5100 2023-03-09
diffoscope JSON 8.8.40-fdroid 5098 2023-03-03
diffoscope JSON 8.8.30-fdroid 4895 2023-03-02
diffoscope JSON 8.8.15-fdroid 4865 2023-02-20
diffoscope JSON 8.8.5-fdroid 4855 2022-12-16
diffoscope JSON 8.5.37-fdroid 4550 2022-08-11
diffoscope JSON 8.3.100-fdroid 4000 2021-03-14
com.forrestguice.suntimeswidget Suntimes diffoscope JSON 0.16.8 122 2025-06-26
diffoscope JSON 0.16.7 121 2025-05-19
diffoscope JSON 0.16.6 120 2025-04-24
diffoscope JSON 0.16.5 119 2025-02-22
diffoscope JSON 0.16.4 118 2025-04-29
diffoscope JSON 0.16.3 117 2024-12-07
diffoscope JSON 0.16.2 116 2024-12-10
diffoscope JSON 0.15.15 112 2024-06-08
diffoscope JSON 0.15.14 111 2024-05-12
diffoscope JSON 0.14.7 91 2022-08-09
diffoscope JSON 0.14.1 85 2022-03-10
diffoscope JSON 0.13.17 81 2022-01-08
diffoscope JSON 0.13.10 74 2021-05-30
diffoscope JSON 0.13.9 73 2021-03-15
diffoscope JSON 0.13.9 73 2021-03-08
diffoscope JSON 0.12.10 62 2021-03-15
diffoscope JSON 0.12.9 61 2021-03-15
diffoscope JSON 0.12.9 61 2020-05-21
diffoscope JSON 0.12.4 56 2021-03-15
diffoscope JSON 0.12.4 56 2020-01-25
diffoscope JSON 0.11.6 47 2021-03-15
diffoscope JSON 0.11.6 47 2019-07-02
diffoscope JSON 0.11.1 42 2021-03-15
diffoscope JSON 0.11.1 42 2019-04-06
diffoscope JSON 0.10.2 39 2021-03-15
diffoscope JSON 0.10.2 39 2019-01-16
diffoscope JSON 0.9.5 36 2021-03-15
diffoscope JSON 0.9.5 36 2018-12-06
diffoscope JSON 0.4.1 12 2021-03-15
diffoscope JSON 0.4.1 12 2018-10-17
diffoscope JSON 0.4.0 11 2021-03-15
diffoscope JSON 0.4.0 11 2018-10-17
com.freerdp.afreerdp aFreeRDP diffoscope JSON 3.14.1 3014010 2025-04-11
diffoscope JSON 3.14.0 3014000 2025-03-25
diffoscope JSON 2.11.0 2011000 2023-12-02
diffoscope JSON 2.4.0 23 2022-08-15
diffoscope JSON 2.3.1 21 2021-03-15
diffoscope JSON 2.3.1 21 2021-03-10
diffoscope JSON 2.0.0-rc4 14 2021-03-15
diffoscope JSON 2.0.0-rc4 14 2019-01-16
com.freshollie.monkeyboard.keystoneradio Monkeyboard Keystone Radio diffoscope JSON 2.1.7-beta 116 2021-03-15
diffoscope JSON 2.1.7-beta 116 2021-03-10
diffoscope JSON 2.1.6-beta 115 2021-03-15
diffoscope JSON 2.1.6-beta 115 2019-04-06
com.fullscreen Diolinux diffoscope JSON 2.2 2 2021-03-15
diffoscope JSON 2.2 2 2018-10-17
com.futurice.android.reservator Reservator diffoscope JSON 4.2.1 17 2021-03-15
com.gabm.screenrotationcontrol Tap 'n' Turn diffoscope JSON 2.8.0 13 2021-03-15
diffoscope JSON 2.8.0 13 2018-10-17
diffoscope JSON 2.5.0 10 2021-03-15
diffoscope JSON 2.5.0 10 2018-10-17
diffoscope JSON 2.2.0 7 2021-03-15
diffoscope JSON 2.2.0 7 2018-10-17
com.gacode.relaunchx ReLaunchX diffoscope JSON 2.1.6 200106000 2023-10-18
diffoscope JSON 1.3.1 100301000 2021-03-15
com.game.Cascada Cascada diffoscope JSON 1.0.1 8 2025-02-26
com.game.asteroids_revenge Asteroid's Revenge diffoscope JSON 0.15.1 100212 2025-07-18
diffoscope JSON 0.15.1 100212 2025-07-17
diffoscope JSON 0.15.1 100211 2025-06-27
diffoscope JSON 0.15.1 100210 2025-06-26
diffoscope JSON 0.14.2 100202 2025-05-29
diffoscope JSON 0.14.2 100201 2025-05-28
diffoscope JSON 0.14.2 100200 2025-05-27
diffoscope JSON 0.14.1 100192 2025-05-02
diffoscope JSON 0.14.1 100191 2025-05-01
diffoscope JSON 0.14.1 100190 2025-04-30
diffoscope JSON 0.14.0 100182 2025-04-20
diffoscope JSON 0.14.0 100181 2025-04-19
diffoscope JSON 0.14.0 100180 2025-04-18
diffoscope JSON 0.13.3 100172 2025-04-17
diffoscope JSON 0.13.3 100171 2025-04-16
diffoscope JSON 0.13.3 100170 2025-04-15
diffoscope JSON 0.13.2 100162 2025-04-11
diffoscope JSON 0.13.2 100161 2025-03-28
diffoscope JSON 0.13.2 100160 2025-03-27
diffoscope JSON 0.13.1 100152 2025-03-13
diffoscope JSON 0.13.1 100151 2025-03-12
diffoscope JSON 0.13.1 100150 2025-03-11
diffoscope JSON 0.12.3 100142 2025-03-05
diffoscope JSON 0.12.3 100141 2025-03-04
diffoscope JSON 0.12.3 100140 2025-03-03
diffoscope JSON 0.12.1 100131 2025-03-02
diffoscope JSON 0.12.1 100130 2025-03-01
com.gbeatty.arxiv arXiv eXplorer - Mobile App for arXiv.org diffoscope JSON 4.0.4 39 2021-03-15
diffoscope JSON 4.0.4 39 2019-12-23
diffoscope JSON 3.5.7 34 2021-03-15
diffoscope JSON 3.5.7 34 2019-01-16
com.gcstar.viewer GCstar Viewer diffoscope JSON 2.12 14 2021-03-15
com.georgeyt9769.cardabase Cardabase diffoscope JSON 1.4.1 903 2025-07-17
diffoscope JSON 1.4.1 902 2025-07-17
diffoscope JSON 1.4.1 901 2025-07-15
diffoscope JSON 1.4.0 803 2025-06-22
diffoscope JSON 1.4.0 802 2025-06-21
diffoscope JSON 1.4.0 801 2025-06-20
com.germainz.identiconizer Identiconizer! diffoscope JSON 1.4 11 2021-03-15
diffoscope JSON 1.4 11 2019-12-22
com.ghstudios.android.mhgendatabase MHGU Database diffoscope JSON 2.3.6 21 2021-03-15
diffoscope JSON 2.3.6 21 2019-12-22
diffoscope JSON 2.3.1 16 2021-03-15
diffoscope JSON 2.3.1 16 2018-12-06
diffoscope JSON 1.1.2 6 2021-03-15
com.gianlu.aria2android Aria2Android diffoscope JSON 2.6.8 76 2024-02-21
diffoscope JSON 2.0.4 46 2021-03-15
diffoscope JSON 2.0.4 46 2019-01-16
diffoscope JSON 1.11.0 40 2021-03-15
diffoscope JSON 1.11.0 40 2018-12-06
com.gianlu.aria2app Aria2App diffoscope JSON 5.9.16 228 2024-02-21
diffoscope JSON 4.2.4 154 2021-03-15
diffoscope JSON 4.2.4 154 2019-01-16
diffoscope JSON 4.1.1 149 2021-03-15
diffoscope JSON 4.1.1 149 2018-12-06
com.github.andremiras.qrscan QRCode & Barcode scanner diffoscope JSON 2020.0528 721202812 2021-03-15
com.github.andremiras.zbarcamdemo zbarcamdemo diffoscope JSON 2020.0524 721202524 2021-03-15
com.github.ashutoshgngwr.noice Noice: Natural calming noise diffoscope JSON 2.5.7 72 2024-06-13
diffoscope JSON 2.5.6 71 2024-01-08
diffoscope JSON 2.5.5 70 2024-01-05
diffoscope JSON 2.5.4 69 2023-10-19
diffoscope JSON 2.5.3 68 2023-10-05
diffoscope JSON 2.5.2 67 2023-04-11
diffoscope JSON 2.5.1 66 2023-04-06
diffoscope JSON 2.4.2 64 2023-02-16
diffoscope JSON 2.4.1 63 2022-12-14
diffoscope JSON 2.2.4 60 2022-11-07
com.github.axet.callrecorder Call Recorder diffoscope JSON 1.8.9 230 2023-12-03
diffoscope JSON 1.8.6 227 2024-06-13
diffoscope JSON 1.8.4 225 2022-08-14
diffoscope JSON 1.7.14 220 2022-01-12
diffoscope JSON 1.7.13 219 2021-03-15
diffoscope JSON 1.7.11 217 2021-03-15
diffoscope JSON 1.7.11 217 2019-12-20
diffoscope JSON 1.6.41 196 2021-03-15
diffoscope JSON 1.6.41 196 2019-01-16
diffoscope JSON 1.6.38 193 2021-03-15
diffoscope JSON 1.6.38 193 2018-12-06
diffoscope JSON 1.4.3 106 2021-03-15
diffoscope JSON 1.4.1 104 2021-03-15
diffoscope JSON 1.3.15 84 2021-03-15
diffoscope JSON 1.3.15 84 2018-10-17
com.github.axet.tonegenerator ToneGenerator.class diffoscope JSON 1.0.13 15 2021-03-15
diffoscope JSON 1.0.12 14 2021-03-15
diffoscope JSON 1.0.11 13 2021-03-15
diffoscope JSON 1.0.11 13 2018-10-17
com.github.catfriend1.syncthingandroid Syncthing-Fork diffoscope JSON 1.30.0.2 1300002 2025-07-26
diffoscope JSON 1.30.0.1 1300001 2025-07-16
diffoscope JSON 1.29.7.5 1290705 2025-07-15
diffoscope JSON 1.29.7.3 1290703 2025-06-13
diffoscope JSON 1.29.7.1 1290701 2025-06-12
diffoscope JSON 1.29.6.5 1290605 2025-06-11
diffoscope JSON 1.29.6.4 1290604 2025-06-10
diffoscope JSON 1.29.6.2 1290602 2025-06-10
diffoscope JSON 1.29.6.0 1290600 2025-05-16
diffoscope JSON 1.29.4.0 1290400 2025-04-10
diffoscope JSON 1.29.2.0 1290200 2025-02-02
diffoscope JSON 1.29.0.0 1290000 2025-01-18
diffoscope JSON 1.27.3.0 1270300 2024-02-10
diffoscope JSON 1.27.2.1 1270201 2024-01-09
diffoscope JSON 1.27.0.1 1270001 2023-12-18
diffoscope JSON 1.26.1.0 1260100 2023-11-25
diffoscope JSON 1.23.6.0 1230600 2023-09-11
diffoscope JSON 1.23.2.2 1230202 2023-03-16
diffoscope JSON 1.23.0.0 1230000 2023-01-09
diffoscope JSON 1.22.2.2 1220202 2022-12-14
diffoscope JSON 1.22.1.0 1220100 2022-11-05
diffoscope JSON 1.20.3.1 1200301 2022-08-11
diffoscope JSON 1.13.1.1 1130101 2021-03-15
diffoscope JSON 1.13.1.1 1130101 2021-03-08
diffoscope JSON 1.6.0.4 1060004 2021-03-15
diffoscope JSON 1.3.3.4 1030304 2021-03-15
diffoscope JSON 1.3.3.4 1030304 2020-01-24
diffoscope JSON 1.3.2.4 1030204 2021-03-15
diffoscope JSON 1.3.2.4 1030204 2019-12-20
diffoscope JSON 1.0.0.5 1000005 2021-03-15
diffoscope JSON 1.0.0.5 1000005 2019-01-16
com.github.characterdog.bmicalculator BMI Calculator diffoscope JSON 1.3 3 2021-03-15
diffoscope JSON 1.3 3 2018-12-06
com.github.darthjoey91.hangman Hangman diffoscope JSON 0.3.1-alpha 4 2021-03-15
diffoscope JSON 0.3.1-alpha 4 2018-10-17
com.github.dfa.diaspora_android dandelion* diffoscope JSON 1.3.5 46 2021-03-15
diffoscope JSON 1.3.5 46 2021-03-09
diffoscope JSON 1.3.4 45 2021-03-15
diffoscope JSON 1.3.3 44 2021-03-15
diffoscope JSON 1.3.3 44 2020-01-25
diffoscope JSON 1.3.2 43 2021-03-15
diffoscope JSON 1.3.2 43 2019-12-22
diffoscope JSON 1.2.5 40 2021-03-15
diffoscope JSON 1.2.5 40 2019-01-16
diffoscope JSON 1.2.4 37 2021-03-15
diffoscope JSON 1.2.4 37 2018-12-06
diffoscope JSON 1.0.6 26 2021-03-15
diffoscope JSON 1.0.6 26 2018-10-17
diffoscope JSON 1.0.4 24 2021-03-15
diffoscope JSON 1.0.4 24 2018-10-17
diffoscope JSON 1.0.0 20 2021-03-15
diffoscope JSON 1.0.0 20 2018-10-17
diffoscope JSON 0.2.7 17 2021-03-15
diffoscope JSON 0.2.7 17 2018-10-17
diffoscope JSON 0.2.4 14 2021-03-15
diffoscope JSON 0.2.4 14 2018-10-17
com.github.egonw.isotopes Isotopes diffoscope JSON 2.0 2 2021-03-15
diffoscope JSON 2.0 2 2018-10-17
com.github.gianlucanitti.expreval ExprEval diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
com.github.grimpy.botifier Botifier diffoscope JSON 1.4.1 16 2021-03-15
diffoscope JSON 1.4.1 16 2018-10-17
com.github.howeyc.crocgui croc diffoscope JSON 1.10.14 34 2024-04-10
diffoscope JSON 1.10.13 33 2023-11-26
diffoscope JSON 1.10.11 31 2023-05-18
diffoscope JSON 1.10.10 30 2023-03-25
diffoscope JSON 1.10.9 29 2023-02-19
diffoscope JSON 1.10.8 28 2022-12-31
diffoscope JSON 1.10.7 27 2022-12-25
diffoscope JSON 1.10.6 26 2022-12-18
diffoscope JSON 1.10.5 25 2022-12-14
diffoscope JSON 1.10.4 24 2022-08-11
com.github.metacubex.clash.meta Clash Meta For Android diffoscope JSON 2.11.13.Meta 211013 2025-07-15
diffoscope JSON 2.11.12.Meta 211012 2025-06-09
diffoscope JSON 2.11.11.Meta 211011 2025-05-27
diffoscope JSON 2.11.10.Meta 211010 2025-05-19
diffoscope JSON 2.11.8.Meta 211008 2025-04-30
diffoscope JSON 2.11.7.Meta 211007 2025-04-10
diffoscope JSON 2.11.6.Meta 211006 2025-02-21
diffoscope JSON 2.11.5.Meta 211005 2025-01-31
diffoscope JSON 2.11.4.Meta 211004 2025-01-21
diffoscope JSON 2.11.2.Meta 211002 2024-12-07
diffoscope JSON 2.11.1.Meta 211001 2024-12-10
diffoscope JSON 2.11.0.Meta 211000 2024-12-14
diffoscope JSON 2.10.0.Meta 210000 2024-02-02
diffoscope JSON 2.8.10.Meta-Alpha 208010 2023-11-27
diffoscope JSON 2.8.2.Meta-Alpha 208002 2023-05-11
diffoscope JSON 2.7.4.Meta-Alpha 207004 2023-04-30
diffoscope JSON 2.7.3.Meta-Alpha 207003 2023-04-27
diffoscope JSON 2.7.2.Meta-Alpha 207002 2023-04-20
diffoscope JSON 2.6.8.Meta-Alpha 206008 2023-03-03
diffoscope JSON 2.6.7.Meta-Alpha 206007 2023-02-23
diffoscope JSON 2.5.13-pre03.Meta-Alpha 205013 2022-12-13
diffoscope JSON 2.5.11-pre01.Meta-Alpha 205011 2022-11-09
com.github.mkalmousli.floating_volume Floating Volume diffoscope JSON 0.0.1 1 2025-07-16
com.github.mofosyne.tagdrop tagdrop diffoscope JSON 1.3 4 2021-03-15
diffoscope JSON 1.3 4 2018-10-17
com.github.msx80.doorsofdoom Doors of Doom diffoscope JSON 0.0.4 1 2024-06-08
com.github.muellerma.mute_reminder Mute reminder diffoscope JSON 2.15 23 2025-07-26
diffoscope JSON 2.14 22 2025-07-16
diffoscope JSON 2.13 20 2024-12-07
diffoscope JSON 2.12 19 2024-12-10
diffoscope JSON 2.11 18 2023-12-17
diffoscope JSON 2.10 17 2023-09-02
diffoscope JSON 2.9 16 2024-06-08
diffoscope JSON 2.8 15 2023-04-03
diffoscope JSON 2.7 14 2023-03-01
diffoscope JSON 2.6 13 2023-02-20
diffoscope JSON 2.3 10 2022-12-22
diffoscope JSON 2.2 9 2022-12-19
diffoscope JSON 2.1 8 2022-11-04
com.github.muellerma.tabletoptools Tabletop Tools diffoscope JSON 1.29 30 2024-06-13
diffoscope JSON 1.28 29 2024-02-06
diffoscope JSON 1.27 28 2024-01-12
diffoscope JSON 1.26 27 2023-12-18
diffoscope JSON 1.25 26 2023-11-30
diffoscope JSON 1.24 25 2023-11-26
diffoscope JSON 1.23 24 2023-09-01
diffoscope JSON 1.20 21 2023-04-07
diffoscope JSON 1.19 20 2023-01-11
diffoscope JSON 1.18 19 2022-12-21
diffoscope JSON 1.17 18 2022-12-15
com.github.shadowsocks Shadowsocks diffoscope JSON 5.3.4-nightly 5030450 2024-12-14
diffoscope JSON 5.3.3-nightly 5030350 2023-02-15
diffoscope JSON 5.3.2-nightly 5030250 2022-12-24
diffoscope JSON 5.3.0-nightly 5030050 2022-08-12
com.github.shadowsocks.plugin.v2ray V2ray Plugin diffoscope JSON 1.3.3 1030300 2021-03-15
com.github.shadowsocks.tv Shadowsocks diffoscope JSON 5.3.4-nightly 5030450 2024-12-14
diffoscope JSON 5.3.3-nightly 5030350 2023-02-14
diffoscope JSON 5.3.2-nightly 5030250 2022-12-24
diffoscope JSON 5.3.0-nightly 5030050 2022-08-12
com.github.timnew.smartremotecontrol Smart Remote Control diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.github.trilinder.tapasclient OpenTapasReader diffoscope JSON 1.0.0 1 2024-02-20
com.github.webierta.call_counter Call Counter diffoscope JSON 2.1.1 5 2022-12-17
diffoscope JSON 1.2.0 2 2021-03-15
diffoscope JSON 1.2.0 2 2021-03-08
com.github.yeriomin.dumbphoneassistant Dumbphone Assistant diffoscope JSON 0.5 5 2021-03-15
com.github.yeriomin.smsscheduler SMS Scheduler diffoscope JSON 0.5 5 2021-03-15
com.gitlab.schaerphix_tool_nideau.nideau NiDeau diffoscope JSON 2.1.0 2 2024-03-02
diffoscope JSON 2.0.10 1 2023-12-01
com.gitlab.uak.mobile_paper_wallet Mobile Paper Wallet diffoscope JSON 1.4.1 102110401 2023-12-02
com.glanznig.beepme BeepMe diffoscope JSON 1.5.5 22 2021-03-15
diffoscope JSON 1.5.5 22 2018-10-17
com.gmail.blandilyte.silverdict SilverDict diffoscope JSON 1.4.1 124 2024-02-18
com.gmail.cn.leetao94.rssaid RSSAid diffoscope JSON 3.0.4 14 2025-03-04
diffoscope JSON 3.0.3 13 2024-12-14
diffoscope JSON 1.6.4 3 2022-08-13
com.gmail.jerickson314.sdscanner SD Scanner diffoscope JSON 1.12.0 13 2021-03-15
com.gmail.jiwopene.temperature Temp. monitor diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-12-07
com.gnethomelinux.midistrum midistrum diffoscope JSON 0.2.9 1021209 2023-11-27
com.gokadzev.musify.fdroid Musify diffoscope JSON 9.6.1 135 2025-07-26
diffoscope JSON 9.6.0 134 2025-07-17
diffoscope JSON 9.5.2 133 2025-06-05
diffoscope JSON 9.4.3 130 2025-05-30
diffoscope JSON 9.3.2 126 2025-05-09
diffoscope JSON 9.3.1 125 2025-05-08
diffoscope JSON 9.2.4 121 2025-03-23
diffoscope JSON 9.2.3 120 2025-03-22
diffoscope JSON 9.2.0 117 2025-03-07
diffoscope JSON 9.0.5 112 2025-02-01
diffoscope JSON 9.0.4 111 2025-01-17
diffoscope JSON 9.0.3 110 2025-01-21
com.goltzkiste.guessaday Guessaday diffoscope JSON 1.02 6 2021-03-15
com.gonnaggstudio.oh_tai_gi 熊愛學臺語 diffoscope JSON 1.0.21 22 2022-08-11
com.google.android.diskusage DiskUsage diffoscope JSON 5.0-alpha1 5001 2023-12-24
diffoscope JSON 3.8.0 3080 2021-03-15
diffoscope JSON 3.8.0 3080 2018-10-17
com.google.zxing.client.android Barcode Scanner diffoscope JSON 4.7.3 103 2021-03-15
diffoscope JSON 4.7.3 103 2018-10-17
com.googlecode.gogodroid GogoDroid diffoscope JSON 2.1 21 2021-03-15
diffoscope JSON 2.1 21 2018-10-17
com.governikus.ausweisapp2 AusweisApp diffoscope JSON 2.1.0 131 2024-03-10
diffoscope JSON 2.0.3 129 2024-02-20
diffoscope JSON 1.22.6 96 2022-08-13
diffoscope JSON 1.22.2 7 2022-01-08
diffoscope JSON 1.22.0 5 2021-03-15
diffoscope JSON 1.22.0 5 2021-03-06
diffoscope JSON 1.20.0 3 2021-03-15
diffoscope JSON 1.20.0 3 2020-01-26
com.graphhopper.maps GraphHopper Maps diffoscope JSON 1.5.1 12 2024-05-10
diffoscope JSON 1.5.0 11 2024-03-29
com.greenaddress.greenbits_android_wallet Green: Bitcoin Wallet diffoscope JSON 4.0.21 22000421 2024-02-20
com.gtp.showapicturetoyourfriend Secure photo viewer diffoscope JSON 1.4 5 2021-03-15
diffoscope JSON 1.4 5 2018-12-06
com.gulshansingh.hackerlivewallpaper Hacker Live Wallpaper diffoscope JSON 1.8.2 13 2021-03-15
diffoscope JSON 1.8.2 13 2018-10-17
com.gunshippenguin.openflood Open Flood diffoscope JSON 1.3.5 12 2021-03-15
com.guozhigq.pilipala PiliPala diffoscope JSON 1.0.23 10233 2024-05-17
diffoscope JSON 1.0.21 10213 2024-03-10
diffoscope JSON 1.0.19 10193 2024-02-19
com.halftough.webcomreader Tinte Webcoms diffoscope JSON 0.2.0 4 2021-03-15
diffoscope JSON 0.2.0 4 2019-12-23
com.hardcodecoder.pulsemusic Pulse Music diffoscope JSON 4.1.1 210040101 2021-04-04
diffoscope JSON 4.1.0 210040100 2021-03-15
diffoscope JSON 4.0.6 210040006 2021-03-15
diffoscope JSON 4.0.6 210040006 2021-03-08
com.harleensahni.android.mbr Media Button Router diffoscope JSON 1.5.1 20140127 2021-03-15
diffoscope JSON 1.5.1 20140127 2018-10-17
com.hassaneltantawy.alazkar Al-Azkar diffoscope JSON 1.1.0 13 2025-07-17
com.health.openscale openScale diffoscope JSON 2.5.4 66 2025-07-15
diffoscope JSON 2.5.1 63 2023-03-01
diffoscope JSON 2.4.6 61 2022-08-14
diffoscope JSON 2.4.5 60 2022-01-09
diffoscope JSON 2.3.5 54 2021-03-15
diffoscope JSON 2.3.5 54 2021-03-09
diffoscope JSON 1.8.4 32 2021-03-15
diffoscope JSON 1.8.4 32 2019-01-16
diffoscope JSON 1.8.3 31 2021-03-15
diffoscope JSON 1.8.3 31 2018-12-07
diffoscope JSON 1.5.5 18 2021-03-15
diffoscope JSON 1.5.5 18 2018-10-17
diffoscope JSON 1.5.2 15 2021-03-15
diffoscope JSON 1.5.2 15 2018-10-17
com.hectorone.multismssender Multi Sms diffoscope JSON 2.8 18 2021-03-15
diffoscope JSON 2.8 18 2018-10-17
com.hexad.bluezime Bluez IME diffoscope JSON 1.20 20 2021-03-15
diffoscope JSON 1.20 20 2018-10-17
com.hg.openwrtmanager OpenWrt Manager diffoscope JSON 1.39.0 201391 2025-06-13
diffoscope JSON 1.38.0 201380 2025-04-11
diffoscope JSON 1.37.0 201370 2025-06-10
diffoscope JSON 1.36.0 201360 2025-01-18
com.iakmds.librecamera Libre Camera diffoscope JSON 1.8.0 121 2024-06-13
com.iamtrk.androidexplorer Android Explorer diffoscope JSON 1.0 1 2021-03-15
com.iazasoft.footguy Footguy diffoscope JSON 1.5 6 2021-03-15
com.iboalali.sysnotifsnooze Hide "running in the background" Notification diffoscope JSON v1.7vc102-fdroid 102 2021-03-15
diffoscope JSON v1.7vc102-fdroid 102 2019-07-11
com.icechen1.notable.pro Notable Plus diffoscope JSON 1.6.0 44 2021-03-15
diffoscope JSON 1.6.0 44 2018-10-17
com.ichi2.anki AnkiDroid: Flashcards diffoscope JSON 2.20.1 22001300 2025-01-21
diffoscope JSON 2.20.0 22000300 2025-04-29
diffoscope JSON 2.19.3 21903300 2024-12-05
diffoscope JSON 2.19.2 21902300 2024-12-07
diffoscope JSON 2.19.1 21901300 2024-12-07
diffoscope JSON 2.18.1 21801300 2024-06-13
diffoscope JSON 2.17.6 21706300 2024-03-17
diffoscope JSON 2.17.5 21705300 2024-03-09
diffoscope JSON 2.17.1 21701300 2024-02-29
diffoscope JSON 2.16.5 21605300 2024-02-21
diffoscope JSON 2.8.2 20802300 2021-03-15
com.imcys.bilibilias BILIBILIAS diffoscope JSON 2.1.5 215 2025-07-16
diffoscope JSON 2.1.0 210 2025-03-18
com.indieweb.indigenous IndiePass diffoscope JSON 0.84 84 2023-05-05
diffoscope JSON 0.82 82 2023-05-02
com.infomaniak.drive Infomaniak kDrive diffoscope JSON 5.6.7 50600701 2025-07-26
diffoscope JSON 5.6.5 50600501 2025-07-17
diffoscope JSON 5.6.4 50600401 2025-07-15
diffoscope JSON 5.6.3 50600301 2025-07-17
diffoscope JSON 5.5.0 50500001 2025-05-19
diffoscope JSON 5.4.6 50400601 2025-05-04
diffoscope JSON 5.4.5 50400501 2025-04-30
diffoscope JSON 5.4.4 50400401 2025-04-24
diffoscope JSON 5.4.3 50400301 2025-04-10
diffoscope JSON 5.4.2 50400201 2025-03-18
diffoscope JSON 5.4.1 50400101 2025-03-14
diffoscope JSON 5.4.0 50400001 2025-03-13
diffoscope JSON 5.3.3 50300301 2025-02-25
diffoscope JSON 5.3.1 50300101 2025-02-22
diffoscope JSON 5.2.6 50200601 2024-12-10
diffoscope JSON 5.2.5 50200501 2024-12-07
diffoscope JSON 5.2.4 50200401 2024-12-06
diffoscope JSON 5.2.3 50200301 2024-12-02
diffoscope JSON 4.2.11 40201102 2022-12-15
com.infomaniak.sync Infomaniak kSync diffoscope JSON 4.3.14 403140003 2024-06-13
diffoscope JSON 4.3.9 403090002 2023-11-26
diffoscope JSON 4.3.8 403080000 2023-10-16
diffoscope JSON 4.3.7 403070001 2023-10-01
diffoscope JSON 4.3.5.2 403050200 2023-09-01
diffoscope JSON 4.3.1 403010002 2023-04-22
diffoscope JSON 4.3 403000005 2023-02-18
diffoscope JSON 4.2.4 402040002 2022-11-06
diffoscope JSON 4.1.1 401010002 2022-08-15
diffoscope JSON 1.5.2 27 2021-03-15
diffoscope JSON 1.5.2 27 2021-03-11
diffoscope JSON 1.5.1 26 2021-03-15
diffoscope JSON 1.5.1 26 2020-05-21
diffoscope JSON 1.3 23 2021-03-15
diffoscope JSON 1.3 23 2019-12-20
com.innodroid.mongobrowser Mongo Explorer diffoscope JSON 2.0.0 10 2021-03-15
diffoscope JSON 2.0.0 10 2018-10-17
com.invoiceninja.app Invoice Ninja diffoscope JSON 5.0.157 157 2024-05-11
diffoscope JSON 5.0.105 105 2023-02-17
diffoscope JSON 5.0.103 103 2022-12-15
diffoscope JSON 5.0.97 97 2022-11-05
com.isanexusdev.androidcpg AndroidCPG diffoscope JSON 1.5 6 2021-03-15
diffoscope JSON 1.5 6 2018-10-17
com.isdp.trirose Tri Rose diffoscope JSON 1.0 2 2021-03-15
diffoscope JSON 1.0 2 2018-10-17
com.jaimegonzalezfabregas.shoppinglist Shopping List diffoscope JSON 1.0.0 1 2025-07-26
com.javierllorente.adc Diccionario castellano diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.jerboa Jerboa for Lemmy diffoscope JSON 0.0.79 79 2025-06-13
diffoscope JSON 0.0.76-gplay 76 2024-12-10
diffoscope JSON 0.0.50 50 2023-11-26
diffoscope JSON 0.0.16 15 2022-08-10
com.jkcarino.ankieditor AnkiEditor diffoscope JSON 0.2.4 9 2021-03-15
diffoscope JSON 0.2.4 9 2019-04-06
com.jmstudios.chibe Chibe diffoscope JSON 1.2.1 4 2021-03-15
diffoscope JSON 1.2.1 4 2018-10-17
diffoscope JSON 1.1.0 2 2021-03-15
diffoscope JSON 1.1.0 2 2018-10-17
com.jmstudios.pointandhit.android Point & Hit diffoscope JSON 1.1.0 12 2021-03-15
diffoscope JSON 1.1.0 12 2018-10-17
com.joshtwigg.cmus.droid Cmus Remote diffoscope JSON 1.4.3 8 2021-03-15
com.jotabout.screeninfo ScreenInfo diffoscope JSON 1.0.7 107 2021-03-15
com.jovial.jrpn JRPN 16c diffoscope JSON 1.1.5 9 2022-01-11
diffoscope JSON 1.1.4.2 8 2021-04-02
diffoscope JSON 1.1.3 7 2021-03-15
diffoscope JSON 1.1.3 7 2021-03-14
com.jstappdev.identify_dog_breeds_pro Identify Dog Breeds Pro diffoscope JSON 30 7202 2024-12-14
diffoscope JSON 30 7201 2024-12-10
diffoscope JSON 27 65 2024-06-13
diffoscope JSON 25 56 2023-02-17
diffoscope JSON 22 53 2022-08-12
com.juet.attendance Attendance Viewer diffoscope JSON 2.1.1 6 2021-03-15
diffoscope JSON 2.1.1 6 2018-10-17
com.juliansparber.captiveportallogin CaptivePortalLogin diffoscope JSON 0.2 2 2021-03-15
com.jwetherell.heart_rate_monitor HeartRateMonitor diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.k.todo Todo diffoscope JSON 1.5.8 10003 2025-07-21
diffoscope JSON 1.5.8 10002 2025-07-20
diffoscope JSON 1.5.8 10001 2025-07-19
diffoscope JSON 1.5.7 9003 2025-07-18
diffoscope JSON 1.5.7 9002 2025-07-18
diffoscope JSON 1.5.7 9001 2025-07-17
diffoscope JSON 1.5.6 8002 2025-06-26
diffoscope JSON 1.5.6 8001 2025-06-23
diffoscope JSON 1.5.5 7003 2025-06-20
diffoscope JSON 1.5.5 7002 2025-06-16
diffoscope JSON 1.5.5 7001 2025-06-09
diffoscope JSON 1.5.1 2003 2025-04-27
com.kaeruct.glxy GLXY diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.kanedias.archforums Archlinux Forums diffoscope JSON 1.2.8 160000 2021-03-15
diffoscope JSON 1.2.8 160000 2021-03-09
com.kanedias.holywarsoo Holywarsoo diffoscope JSON 1.6.0 310000 2022-08-12
diffoscope JSON 1.5.8 280000 2021-03-15
diffoscope JSON 1.5.8 280000 2021-03-10
com.kanedias.vanilla.metadata Vanilla Metadata Fetch diffoscope JSON 1.0.4 5 2021-03-15
diffoscope JSON 1.0.4 5 2019-01-16
com.karin.idTech4Amm idTech4A++ diffoscope JSON 1.1.0harmattan67luyiping 11067 2025-07-16
diffoscope JSON 1.1.0harmattan66lindaiyu 11066 2025-07-18
diffoscope JSON 1.1.0harmattan65lindaiyu 11065 2025-07-19
diffoscope JSON 1.1.0harmattan61caitlyn 11061 2025-04-12
diffoscope JSON 1.1.0harmattan50natasha 11050 2024-05-15
diffoscope JSON 1.1.0harmattan39natasha 11039 2024-06-08
diffoscope JSON 1.1.0harmattan38natasha 11038 2024-02-06
diffoscope JSON 1.1.0harmattan37natasha 11037 2024-01-11
diffoscope JSON 1.1.0harmattan36natasha 11036 2024-01-09
diffoscope JSON 1.1.0harmattan35natasha 11035 2023-11-25
diffoscope JSON 1.1.0harmattan32natasha 11032 2023-07-09
com.kgurgul.cpuinfo CPU Info diffoscope JSON 5.4.0 50400 2024-03-18
diffoscope JSON 4.2.0 40200 2021-03-15
diffoscope JSON 4.2.0 40200 2019-01-16
com.kn.paper_foss_theme Paper diffoscope JSON 1.1.2 26 2021-03-15
diffoscope JSON 1.1.2 26 2018-10-17
com.kunzisoft.keepass.libre KeePassDX - FOSS Password Safe diffoscope JSON 4.1.1 133 2024-12-07
diffoscope JSON 4.1.0 132 2024-12-06
diffoscope JSON 4.0.6 129 2024-05-15
diffoscope JSON 2.9.13 57 2021-03-15
diffoscope JSON 2.9.13 57 2021-03-08
diffoscope JSON 2.6 34 2021-03-15
diffoscope JSON 2.5.0.0beta18 18 2021-03-15
diffoscope JSON 2.5.0.0beta18 18 2018-12-07
com.kyakujin.android.tagnotepad TAG Notepad diffoscope JSON 1.0.2 3 2021-03-15
diffoscope JSON 1.0.2 3 2018-10-17
com.leastauthority.destiny Destiny diffoscope JSON 1.0.3 344 2024-02-23
com.leestarb.fourthtools Fourth Tools diffoscope JSON 3.4.1 341 2022-11-04
diffoscope JSON 3.3.1 331 2024-06-13
diffoscope JSON 3.3.0 330 2024-06-08
com.leinardi.ubuntucountdownwidget Ubuntu Countdown Widget diffoscope JSON 2.0.3 1695620003 2024-02-21
diffoscope JSON v21.04 259 2021-03-15
diffoscope JSON v21.04 259 2021-03-12
com.libopenmw.openmw OpenMW diffoscope JSON 0.46.0 8 2021-03-15
com.linuxcounter.lico_update_003 Linux Counter Updater diffoscope JSON 0.0.8 8 2021-03-15
diffoscope JSON 0.0.8 8 2018-10-17
com.littlebytesofpi.pylauncher pyLauncher diffoscope JSON 1.1.1 5 2021-03-15
diffoscope JSON 1.1.1 5 2018-10-17
com.log28 log28 diffoscope JSON 0.6.2 12 2021-03-15
diffoscope JSON 0.6.2 12 2021-03-10
com.logger.app Logger diffoscope JSON 3.1.2 50 2025-05-16
diffoscope JSON 3.1.0 49 2025-04-15
diffoscope JSON 3.0.8 47 2025-03-28
diffoscope JSON 2.8.3 37 2025-01-20
com.logseq.app Logseq diffoscope JSON 0.10.7 81 2024-03-10
diffoscope JSON 0.10.6 80 2024-02-18
com.lucasdnd.bitclock16 16-bit Clock Widget diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.lucasdnd.decimaltimeclockwidget Decimal Time Clock Widget diffoscope JSON 1.4.1 10 2021-03-15
diffoscope JSON 1.4.1 10 2018-10-17
com.lucasdnd.unixtimeclockwidget Unix Time Clock Widget diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.lyonbros.turtl Turtl diffoscope JSON 0.7.2.5 7250 2021-03-15
diffoscope JSON 0.7.2.5 7250 2019-04-06
com.machiav3lli.fdroid Neo Store diffoscope JSON 1.0.9 1026 2025-04-15
diffoscope JSON 1.0.8 1025 2025-02-23
diffoscope JSON 1.0.6 1023 2025-02-01
diffoscope JSON 1.0.0 1012 2024-06-13
diffoscope JSON 0.9.3 913 2022-08-10
com.mantz_it.rfanalyzer RF Analyzer diffoscope JSON 1.13 1303 2021-03-15
com.marceljurtz.lifecounter LifeCounter diffoscope JSON 2.0 15 2021-03-15
diffoscope JSON 2.0 15 2020-06-11
diffoscope JSON 10 10 2021-03-15
com.massive Massive diffoscope JSON 2.35 36250 2024-06-13
diffoscope JSON 2.34 36249 2024-06-08
com.mathi_amorim.emmanuel.metrictime Metric Time diffoscope JSON 0.1.1 4 2021-03-15
diffoscope JSON 0.1.1 4 2018-10-17
com.mattermost.rnbeta Mattermost Beta diffoscope JSON 2.29.1 64804 2025-06-26
diffoscope JSON 2.29.1 64803 2025-06-25
diffoscope JSON 2.29.1 64802 2025-06-24
diffoscope JSON 2.29.1 64801 2025-06-23
diffoscope JSON 2.28.1 64404 2025-06-16
diffoscope JSON 2.28.1 64403 2025-06-15
diffoscope JSON 2.28.1 64402 2025-06-14
diffoscope JSON 2.28.1 64401 2025-06-13
diffoscope JSON 2.28.0 63804 2025-05-26
diffoscope JSON 2.28.0 63803 2025-05-25
diffoscope JSON 2.28.0 63802 2025-05-24
diffoscope JSON 2.28.0 63801 2025-05-23
diffoscope JSON 2.27.1 63204 2025-05-11
diffoscope JSON 2.27.1 63203 2025-05-10
diffoscope JSON 2.27.1 63202 2025-05-09
diffoscope JSON 2.27.1 63201 2025-05-08
diffoscope JSON 2.27.0 62704 2025-04-30
diffoscope JSON 2.27.0 62703 2025-04-29
diffoscope JSON 2.27.0 62702 2025-04-28
diffoscope JSON 2.27.0 62701 2025-04-27
diffoscope JSON 2.26.2 62004 2025-04-26
diffoscope JSON 2.26.2 62003 2025-04-25
diffoscope JSON 2.26.2 62002 2025-04-24
diffoscope JSON 2.26.2 62001 2025-04-23
diffoscope JSON 2.26.1 61704 2025-04-22
diffoscope JSON 2.26.1 61703 2025-04-21
diffoscope JSON 2.26.1 61702 2025-04-20
diffoscope JSON 2.26.1 61701 2025-04-19
diffoscope JSON 2.26.0 61304 2025-04-18
diffoscope JSON 2.26.0 61303 2025-04-17
diffoscope JSON 2.26.0 61302 2025-04-16
diffoscope JSON 2.26.0 61301 2025-04-16
diffoscope JSON 2.14.0 50902 2024-06-13
diffoscope JSON 2.14.0 50901 2024-06-08
diffoscope JSON 2.13.0 50704 2024-02-19
com.mattgmg.miracastwidget Miracast Shortcut diffoscope JSON 3.1 12 2022-01-12
com.maxrave.simpmusic SimpMusic diffoscope JSON 0.2.17 35 2025-07-16
com.maze_squirrel The Squirrel's Maze 2D diffoscope JSON 1.2.4 124 2024-06-13
com.mendhak.gpslogger GPSLogger diffoscope JSON 134 134 2025-07-17
diffoscope JSON 133 133 2025-01-18
diffoscope JSON 132 132 2024-12-07
diffoscope JSON 130 130 2024-03-31
diffoscope JSON 123 123 2022-11-08
diffoscope JSON 122 122 2022-08-13
diffoscope JSON 110 110 2021-05-29
diffoscope JSON 107-fdroid 107 2021-03-15
diffoscope JSON 107-fdroid 107 2021-03-09
diffoscope JSON 27-fdroid 27 2021-03-15
diffoscope JSON 27-fdroid 27 2018-10-17
com.menny.android.anysoftkeyboard AnySoftKeyboard diffoscope JSON 1.11.7137 7137 2022-08-15
diffoscope JSON 1.8.585 1910 2021-03-15
diffoscope JSON 1.8.585 1910 2018-10-17
com.menny.anysoftkeyboard.finnish Finnish for AnySoftKeyboard diffoscope JSON 2.0.1 201 2021-03-15
com.mhss.app.mybrain My Brain diffoscope JSON 2.0.6 15 2025-06-13
com.midisheetmusic MidiSheetMusic diffoscope JSON 2.5.1 8 2021-03-15
diffoscope JSON 2.5.1 8 2018-10-17
com.mileskrell.texttorch Text Torch diffoscope JSON 1.2.0 5 2022-08-09
com.miqote.shanawp Flame Haze Shana Animated Wallpaper diffoscope JSON 1.0 10 2021-03-15
com.mirfatif.permissionmanagerx Permission Manager X diffoscope JSON v1.23-fd 123 2023-11-27
com.mishiranu.dashchan Dashchan diffoscope JSON 3.1.3 1042 2021-03-15
com.mkulesh.micromath.plus microMathematics Plus diffoscope JSON 2.23.2 324 2024-05-12
diffoscope JSON 2.22.0 319 2021-06-01
diffoscope JSON 2.21.1 318 2021-03-15
diffoscope JSON 2.21.1 318 2021-03-08
diffoscope JSON 2.19.0 314 2021-03-15
diffoscope JSON 2.19.0 314 2020-05-22
diffoscope JSON 2.18.0 313 2021-03-15
diffoscope JSON 2.18.0 313 2019-12-23
diffoscope JSON 2.17.4 312 2021-03-15
diffoscope JSON 2.17.4 312 2019-01-16
diffoscope JSON 2.17.3 311 2021-03-15
diffoscope JSON 2.17.3 311 2018-12-07
diffoscope JSON 2.15.4 302 2021-03-15
diffoscope JSON 2.15.4 302 2018-10-17
com.mobilepearls.sokoban Sokoban diffoscope JSON 1.14 14 2021-03-15
com.monead.games.android.sequence Sequence Hunt diffoscope JSON 01.07.03 21 2021-03-15
diffoscope JSON 01.07.03 21 2018-10-17
com.moonpi.tapunlock TapUnlock diffoscope JSON 2.1.0 beta 13 2021-03-15
diffoscope JSON 2.1.0 beta 13 2018-10-17
com.mridang.throttle Microchip diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.msapps.touchdetector TouchDetector diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.mschlauch.comfortreader Comfort Reader diffoscope JSON 1.9.6 13 2021-03-15
diffoscope JSON 1.9.6 13 2020-01-25
diffoscope JSON 1.9.5 12 2021-03-15
diffoscope JSON 1.9.5 12 2019-07-02
diffoscope JSON 1.9alpha 6 2021-03-15
com.mustafaali.sensorssandbox Sensors Sandbox diffoscope JSON 1.8 8 2021-03-15
diffoscope JSON 1.8 8 2018-10-17
com.nanoconverter.zlab nanoConverter diffoscope JSON 0.8.98 38 2021-03-15
diffoscope JSON 0.8.98 38 2018-10-17
com.nathanosman.chronosnap ChronoSnap diffoscope JSON 1.0.5 6 2021-03-15
com.nbossard.packlist packlist diffoscope JSON 0.11 17 2021-03-15
diffoscope JSON 0.11 17 2018-10-17
com.nesbox.tic TIC-80 diffoscope JSON 1.01.00 10100 2024-02-21
com.neumorphic.calculator Calculator diffoscope JSON 1.1.0 2 2022-03-11
com.nextcloud.talk2 Nextcloud Talk diffoscope JSON 21.1.3 210010390 2025-07-26
diffoscope JSON 21.1.2 210010290 2025-07-17
diffoscope JSON 21.1.1 210010190 2025-07-16
diffoscope JSON 21.1.0 210010090 2025-06-13
diffoscope JSON 21.0.1 210000190 2025-04-24
diffoscope JSON 21.0.0 210000090 2025-03-06
diffoscope JSON 20.1.1 200010190 2025-02-23
diffoscope JSON 20.0.6 200000690 2024-12-05
diffoscope JSON 20.0.5 200000590 2024-12-07
diffoscope JSON 20.0.4 200000490 2024-12-07
diffoscope JSON 19.0.0 190000090 2024-06-13
diffoscope JSON 18.1.0 180010090 2024-03-18
diffoscope JSON 18.0.1 180000190 2023-12-27
diffoscope JSON 18.0.0 180000090 2023-12-17
diffoscope JSON 17.1.3 170100390 2023-11-25
diffoscope JSON 17.1.2 170100290 2023-10-24
diffoscope JSON 17.1.0 170100090 2023-09-19
diffoscope JSON 17.0.2 170000290 2023-09-01
diffoscope JSON 16.0.0 160000090 2023-03-25
diffoscope JSON 15.1.2 150010290 2023-02-20
diffoscope JSON 15.1.1 150010190 2023-02-17
diffoscope JSON 15.0.3 150000390 2022-12-19
diffoscope JSON 15.0.2 150000290 2022-12-14
diffoscope JSON 15.0.1 150000190 2022-11-05
diffoscope JSON 14.1.0 140010090 2022-08-10
diffoscope JSON 13.0.0 130000090 2022-01-09
diffoscope JSON 11.1.2 120000005 2021-04-04
diffoscope JSON 8.0.9 136 2021-03-15
diffoscope JSON 8.0.9 136 2020-05-21
diffoscope JSON 8.0.0 127 2021-03-15
diffoscope JSON 8.0.0 127 2020-01-24
diffoscope JSON 7.0.8 122 2021-03-15
diffoscope JSON 7.0.8 122 2019-12-21
diffoscope JSON 3.2.0beta4 77 2021-03-15
diffoscope JSON 3.2.0beta4 77 2019-01-16
diffoscope JSON 3.1.1 71 2021-03-15
diffoscope JSON 3.1.1 71 2018-12-06
com.nighthawkapps.wallet.android Nighthawk Wallet diffoscope JSON 2.2.16 20216800 2024-12-05
diffoscope JSON 2.2.15 20215800 2024-12-10
diffoscope JSON 2.2.14 20214800 2024-06-13
diffoscope JSON 2.2.12 20212800 2024-02-20
diffoscope JSON 2.2.11 20211800 2024-06-08
diffoscope JSON 2.0.05 20005200 2022-11-04
com.nolanlawson.jnameconverter Japanese Name Converter diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.nononsenseapps.feeder Feeder diffoscope JSON 2.11.5 3691 2025-06-01
diffoscope JSON 2.11.0 3640 2025-04-19
diffoscope JSON 2.10.1 3613 2025-04-16
diffoscope JSON 2.10.0 3602 2025-04-16
diffoscope JSON 1.13.1 102 2021-05-29
diffoscope JSON 1.11.3 98 2021-04-04
diffoscope JSON 1.10.14 94 2021-03-15
diffoscope JSON 1.10.14 94 2021-03-12
diffoscope JSON 1.10.13 93 2021-03-15
diffoscope JSON 1.10.13 93 2021-03-05
diffoscope JSON 1.9.5 75 2021-03-15
diffoscope JSON 1.9.5 75 2020-06-10
diffoscope JSON 1.8.12 51 2021-03-15
diffoscope JSON 1.8.12 51 2019-04-06
diffoscope JSON 1.8.5 44 2021-03-15
diffoscope JSON 1.8.5 44 2019-01-19
diffoscope JSON 1.8.4 43 2021-03-15
diffoscope JSON 1.8.4 43 2019-01-16
diffoscope JSON 1.8.3 42 2021-03-15
diffoscope JSON 1.8.3 42 2018-12-06
diffoscope JSON 1.3.5 12 2021-03-15
diffoscope JSON 1.3.5 12 2018-10-17
com.nononsenseapps.wanidoku WaniDoku diffoscope JSON 1.0.6 7 2021-05-30
diffoscope JSON 1.0.5 6 2021-03-15
diffoscope JSON 1.0.5 6 2021-03-09
com.notecryptpro Note Crypt Pro diffoscope JSON 1.44 22 2021-03-15
diffoscope JSON 1.44 22 2018-12-06
diffoscope JSON 1.42 18 2021-03-15
com.oakley.fon Fon diffoscope JSON 1.5.2 152 2021-03-15
com.olam Olam diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.oml.recordtimedroid Record Time Droid diffoscope JSON 3.00 25 2023-02-27
com.openpi.spellingwizard Spelling Wizard diffoscope JSON 1.0.5 10 2021-03-15
diffoscope JSON 1.0.5 10 2021-03-08
com.orpheusdroid.screenrecorder ScreenCam diffoscope JSON 2.0.0-fdroid 30 2021-03-15
diffoscope JSON 2.0.0-fdroid 30 2019-01-16
diffoscope JSON 1.6.1 13 2021-03-15
com.orpheusdroid.sqliteviewer SQLiteViewer diffoscope JSON 1.0.0 1 2021-03-15
diffoscope JSON 1.0.0 1 2019-04-06
com.osfans.trime Trime diffoscope JSON 3.3.5 20250701 2025-07-16
diffoscope JSON 3.3.4 20250501 2025-05-08
diffoscope JSON 3.3.3 20250301 2025-03-05
diffoscope JSON 3.3.2 20250101 2025-01-18
diffoscope JSON 3.3.1 20241101 2024-12-07
diffoscope JSON 3.3.0 20240901 2024-12-15
diffoscope JSON 3.2.18 20240501 2024-06-14
diffoscope JSON 3.2.17 20240301 2024-06-08
diffoscope JSON 3.2.16 20240101 2024-02-20
com.outerworldapps.wairtonow WairToNow - Aviation Navigation diffoscope JSON 5.1 50100 2021-03-15
diffoscope JSON 5.1 50100 2021-03-07
com.paranoiaworks.unicus.android.sse Secret Space Encryptor (SSE) diffoscope JSON 3.1.0.1 118 2023-02-23
com.passcard PassCard diffoscope JSON 1.5 6 2021-03-15
diffoscope JSON 1.5 6 2018-10-17
com.pavelsof.wormhole Wormhole diffoscope JSON 0.2.1 721201 2021-06-01
com.pcinpact Next Actualités informatiques diffoscope JSON 2.9.1 291 2025-04-29
diffoscope JSON 2.2.7 227 2021-03-15
diffoscope JSON 2.2.7 227 2018-10-17
com.phikal.regex ReGeX diffoscope JSON 1.3.1 5 2021-03-15
diffoscope JSON 1.3.1 5 2018-10-17
com.phpsysinfo PSIAndroid diffoscope JSON 0.91 910 2021-03-15
com.picross.nonocross Nonocross diffoscope JSON 1.3.5 11 2023-09-11
diffoscope JSON 1.2.2 5 2021-05-30
com.pilockerstable Pi Locker diffoscope JSON 3.0 3 2021-03-15
diffoscope JSON 3.0 3 2018-10-17
com.pindroid PinDroid diffoscope JSON 3.3.2 69 2021-03-15
diffoscope JSON 3.3.2 69 2018-10-17
com.platypus.SAnd SAnd diffoscope JSON 1.02 3 2021-03-15
diffoscope JSON 1.02 3 2018-10-17
com.podverse.fdroid Podverse diffoscope JSON 4.16.0 102004 2024-04-10
diffoscope JSON 3.0.8 8 2021-05-30
diffoscope JSON 2.10.1 2 2021-03-10
com.poinsart.votar VotAR diffoscope JSON 1.3.2 9 2021-03-15
diffoscope JSON 1.3.2 9 2018-10-17
com.polipoid Polipoid diffoscope JSON 1.2.2 6 2021-03-15
diffoscope JSON 1.2.2 6 2018-10-17
com.politedroid Polite Droid diffoscope JSON 1.5 6 2021-03-15
diffoscope JSON 1.5 6 2018-10-17
com.poppingmoon.aria Aria for Misskey diffoscope JSON 1.2.4 683 2025-07-24
diffoscope JSON 1.2.4 682 2025-07-23
diffoscope JSON 1.2.4 681 2025-07-22
diffoscope JSON 1.2.3 673 2025-07-21
diffoscope JSON 1.2.3 672 2025-07-18
diffoscope JSON 1.2.3 671 2025-07-17
diffoscope JSON 1.2.2 663 2025-07-20
diffoscope JSON 1.2.2 662 2025-07-19
diffoscope JSON 1.2.2 661 2025-07-18
diffoscope JSON 1.1.1 631 2025-06-26
diffoscope JSON 1.0.3 613 2025-04-18
diffoscope JSON 1.0.3 612 2025-04-17
diffoscope JSON 1.0.3 611 2025-04-16
diffoscope JSON 1.0.1 593 2025-04-15
com.poupa.vinylmusicplayer Vinyl Music Player diffoscope JSON 1.10.2 199 2024-06-14
diffoscope JSON 1.8.2 193 2024-03-18
diffoscope JSON 1.8.1 192 2024-03-10
diffoscope JSON 1.8.0 191 2024-02-15
diffoscope JSON 1.7.0 190 2024-02-03
diffoscope JSON 1.6.3 189 2023-12-27
diffoscope JSON 1.6.2 188 2023-12-17
diffoscope JSON 1.6.1 187 2023-11-30
diffoscope JSON 1.5.6 185 2023-11-26
diffoscope JSON 1.5.5 184 2023-10-23
diffoscope JSON 1.5.4 183 2023-10-15
diffoscope JSON 1.5.3 182 2023-10-13
diffoscope JSON 1.5.2 181 2023-07-10
diffoscope JSON 1.5.0 180 2023-02-23
diffoscope JSON 1.4.1 179 2023-02-16
diffoscope JSON 1.4.0 178 2023-01-10
diffoscope JSON 1.3.0 177 2022-01-11
diffoscope JSON 1.2.0 176 2021-05-30
diffoscope JSON 1.1.2 175 2021-03-15
diffoscope JSON 1.1.1 174 2021-03-15
diffoscope JSON 1.1.1 174 2021-03-06
com.prhlt.aemus.Read4SpeechExperiments Read4SpeechExperiments diffoscope JSON 1.06 18 2021-03-15
com.pvpc.precio_luz Precio Luz diffoscope JSON 2.4.1 24 2022-08-16
diffoscope JSON 1.1.1 2 2021-03-15
com.quaap.audiometer AudioMeter diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
com.quaap.computationaldemonology Computational Demonology diffoscope JSON 0.1 1 2021-03-15
diffoscope JSON 0.1 1 2018-10-17
com.quaap.dodatheexploda Doda The Exploda diffoscope JSON 0.2 2 2021-03-15
com.quaap.fishberserker Seafood Berserker! diffoscope JSON 0.2.2 22 2021-03-15
diffoscope JSON 0.2.2 22 2018-10-17
diffoscope JSON 0.2 2 2021-03-15
diffoscope JSON 0.2 2 2018-10-17
com.quaap.phonefonefun PhoneFoneFun diffoscope JSON 1.2 12 2021-03-15
com.quaap.primary Primary diffoscope JSON 0.3.2 32 2021-03-15
diffoscope JSON 0.3 3 2021-03-15
com.quinncasey.paperless_share Paperless Share diffoscope JSON 1.1.4 1011 2022-08-15
diffoscope JSON 1.0.5 1005 2021-03-15
diffoscope JSON 1.0.5 1005 2021-03-09
com.ranger.blastoff BlastOff diffoscope JSON 1.5.1 100016 2025-04-19
com.rareventure.gps2 Tiny Travel Tracker diffoscope JSON 1.1.48 91 2021-03-15
diffoscope JSON 1.1.48 91 2019-12-21
com.readrops.app Readrops diffoscope JSON 2.1.1 22 2025-07-16
diffoscope JSON 2.0.3 20 2025-04-29
diffoscope JSON 2.0.2 19 2024-12-06
diffoscope JSON 2.0.1 18 2024-12-10
diffoscope JSON 1.1.4 10 2021-03-15
diffoscope JSON 1.1.4 10 2020-05-21
com.redblaster.hsl.main Helsinki Timetables diffoscope JSON 1.6 37 2021-03-15
diffoscope JSON 1.6 37 2019-12-22
com.retroarch RetroArch diffoscope JSON 1.21.0 1597175264 2025-05-04
diffoscope JSON 1.20.0 1597175263 2025-01-17
diffoscope JSON 1.19.0 1597175261 2024-06-14
diffoscope JSON 1.18.0 1597175260 2024-03-24
diffoscope JSON 1.17.0 1597175259 2024-02-10
diffoscope JSON 1.16.0 1597175258 2023-12-02
diffoscope JSON 1.15.0 1597175256 2023-05-02
com.ridgelineapps.resdicegame Catan Dice Game diffoscope JSON 1.15 16 2021-03-15
com.rigid.birthdroid Birthdroid diffoscope JSON 0.6.4 64 2021-03-15
diffoscope JSON 0.6.4 64 2018-10-17
com.rocket9labs.boxcars Boxcars diffoscope JSON 1.4.9 104090 2025-06-20
diffoscope JSON 1.4.8 104080 2025-02-21
diffoscope JSON 1.4.7 104070 2024-12-09
diffoscope JSON 1.4.6 104060 2024-12-07
diffoscope JSON 1.4.5 104050 2024-12-07
diffoscope JSON 1.3.2 103020 2024-06-14
diffoscope JSON 1.3.1 103010 2024-02-25
diffoscope JSON 1.3.0 103000 2024-02-15
diffoscope JSON 1.2.9 102090 2024-02-02
diffoscope JSON 1.1.5 101050 2023-12-01
com.rogerbassonsrenart.paddletennis PaddleTennis diffoscope JSON 1.5.4 12 2021-03-15
diffoscope JSON 1.5.4 12 2018-10-17
com.rubenroy.minimaltodo Minimal diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
com.ruesga.android.wallpapers.photophase PhotoPhase diffoscope JSON 2.6.1 1035 2021-03-15
diffoscope JSON 2.6.1 1035 2018-10-17
diffoscope JSON 2.5.1 1033 2021-03-15
diffoscope JSON 2.5.1 1033 2018-10-17
com.s4nj1th.pocket_dhamma PocketDhamma diffoscope JSON 1.2.2 1223 2025-06-18
diffoscope JSON 1.2.2 1222 2025-06-17
diffoscope JSON 1.2.2 1221 2025-06-16
com.sagar.screenshift2 Screen Shift diffoscope JSON 2.0 4 2021-03-15
com.saiga.find.messagefinder Priority Alerts diffoscope JSON 2.9.8 16 2021-03-15
diffoscope JSON 2.9.8 16 2021-03-09
com.samco.trackandgraph Track & Graph diffoscope JSON 6.0.0 600000 2025-05-30
diffoscope JSON 2.1.1 200101 2022-01-09
diffoscope JSON 1.13.1 101301 2021-05-31
diffoscope JSON 1.11.1 101101 2021-04-04
diffoscope JSON 1.10.4 101004 2021-03-15
diffoscope JSON 1.10.4 101004 2021-03-08
com.samebits.beacon.locator Beacon Locator diffoscope JSON 1.2.2 122 2021-03-15
diffoscope JSON 1.2.2 122 2019-12-23
diffoscope JSON 1.2.1 121 2021-03-15
diffoscope JSON 1.2.1 121 2018-12-07
diffoscope JSON 1.1.5 115 2021-03-15
diffoscope JSON 1.1.5 115 2018-10-17
diffoscope JSON 1.1.4 114 2021-03-15
diffoscope JSON 1.1.4 114 2018-10-17
diffoscope JSON 1.1.1 111 2021-03-15
com.sandeel.bushidoblocks Bushido Blocks diffoscope JSON 1.4 13 2021-03-15
diffoscope JSON 1.4 13 2018-10-17
com.sanskritbasics SanskritBasicsLetters diffoscope JSON 3.3 33 2022-12-14
diffoscope JSON 3.1 31 2021-03-15
diffoscope JSON 3.1 31 2021-03-09
com.sanskritbasics.memory Memory diffoscope JSON 3.3 33 2022-12-14
diffoscope JSON 3.2 32 2021-03-15
diffoscope JSON 3.2 32 2021-03-09
diffoscope JSON 2.6 20 2021-03-15
diffoscope JSON 2.6 20 2020-05-21
com.sensirion.smartgadget Smart Gadget diffoscope JSON 1.8.7 96 2021-03-15
com.serwylo.babybook Baby Books diffoscope JSON 0.9.1 11 2023-09-02
com.serwylo.beatgame Beat Feet diffoscope JSON 0.16.1 34 2024-01-05
diffoscope JSON 0.16.0 33 2023-10-21
diffoscope JSON 0.15.0 32 2023-09-15
diffoscope JSON 0.14.9 31 2023-09-01
diffoscope JSON 0.14.5 27 2023-07-06
diffoscope JSON 0.14.4 26 2022-12-17
diffoscope JSON 0.12.3 16 2022-01-11
com.shurik.droidzebra DroidZebra diffoscope JSON 1.5.3 17 2021-03-15
diffoscope JSON 1.5.3 17 2018-10-17
com.sigmarelax.doitoscihub DOI to SciHub diffoscope JSON 1.2.0 3 2021-03-15
diffoscope JSON 1.2.0 3 2021-03-09
diffoscope JSON 1.1.0 2 2021-03-15
diffoscope JSON 1.1.0 2 2019-12-22
com.simondalvai.ball2box Ball2Box diffoscope JSON 4.1.7 67 2025-06-09
diffoscope JSON 4.1.6 66 2025-03-01
diffoscope JSON 4.1.0 60 2024-02-20
diffoscope JSON 4.0.3 59 2024-01-05
diffoscope JSON 4.0.1 57 2023-11-27
diffoscope JSON 2.3.6 54 2023-07-09
diffoscope JSON 2.3.5 53 2023-05-31
diffoscope JSON 2.3.2 50 2023-05-07
diffoscope JSON 2.2.6 44 2023-03-09
com.simondalvai.pocketbroomball Pocket Broomball diffoscope JSON 6.1.3 100 2025-03-27
diffoscope JSON 6.1.2 99 2025-03-22
diffoscope JSON 6.1.1 98 2025-03-05
diffoscope JSON 6.1.0 97 2025-02-21
diffoscope JSON 5.2.0 94 2024-03-21
diffoscope JSON 5.1.2 92 2024-02-10
com.sinpo.xnfc NFCard diffoscope JSON 2.2.150720 15 2021-03-15
diffoscope JSON 2.2.150720 15 2018-10-17
com.smithdtyler.prettygoodmusicplayer.launchermode Pretty Good Music Player Launcher Mode diffoscope JSON 3.2.7L 58 2021-03-15
diffoscope JSON 3.2.7L 58 2018-10-17
com.softcodingforyou.touchtorch Touch Torch diffoscope JSON 1.0.6 7 2025-04-30
com.sovworks.edslite EDS Lite diffoscope JSON 2.0.0.237 237 2021-03-15
diffoscope JSON 2.0.0.237 237 2021-03-12
com.soyblue.bluesound Blue Mono Sound diffoscope JSON 1.4 10 2021-03-15
diffoscope JSON 1.4 10 2018-10-17
com.spacestation14.Smile Smile SS14 diffoscope JSON 1.0.4 5 2025-05-19
com.streetwriters.notesnook Notesnook - Private notes app diffoscope JSON 3.0.32 15214 2025-03-27
diffoscope JSON 3.0.32 15213 2025-03-25
diffoscope JSON 3.0.32 15212 2025-03-17
diffoscope JSON 3.0.32 15211 2025-03-13
diffoscope JSON 3.0.31 15209 2025-03-11
diffoscope JSON 3.0.31 15207 2025-03-07
diffoscope JSON 3.0.31 15206 2025-03-05
diffoscope JSON 3.0.30 15204 2025-03-02
diffoscope JSON 3.0.30 15203 2025-03-01
diffoscope JSON 3.0.30 15202 2025-02-27
diffoscope JSON 3.0.30 15201 2025-02-27
diffoscope JSON 3.0.26 15181 2025-01-18
diffoscope JSON 3.0.25 15176 2025-01-21
diffoscope JSON 3.0.11 10448 2024-04-13
diffoscope JSON 2.6.17 10424 2024-03-12
diffoscope JSON 2.6.15 10379 2024-02-19
com.superproductivity.superproductivity Super Productivity diffoscope JSON 14.2.2 1402020000 2025-07-26
diffoscope JSON 14.0.5 1400050000 2025-07-18
diffoscope JSON 14.0.2 1400020000 2025-07-17
diffoscope JSON 14.0.1 1400010000 2025-07-16
diffoscope JSON 13.1.2 1301020000 2025-06-26
diffoscope JSON 13.1.0 1301000000 2025-06-23
diffoscope JSON 13.0.11 1300110000 2025-06-16
diffoscope JSON 13.0.10 1300100000 2025-05-23
diffoscope JSON 13.0.4 1300040000 2025-05-19
diffoscope JSON 12.0.5 1200050000 2025-04-19
diffoscope JSON 12.0.3 1200030000 2025-04-10
diffoscope JSON 12.0.1 1200010000 2025-03-22
diffoscope JSON 12.0.0 1200000000 2025-03-13
diffoscope JSON 11.1.3 1101030000 2025-02-21
diffoscope JSON 11.1.2 1101020000 2025-01-20
diffoscope JSON 11.1.1 1101010000 2025-01-18
diffoscope JSON 11.0.3 1100030000 2025-01-21
com.tailscale.ipn Tailscale diffoscope JSON 1.82.4-tb45366c80-gce6fa05d5 395 2025-04-19
diffoscope JSON 1.80.0-t4f4686503-gb1405a1d1 358 2025-03-01
diffoscope JSON 1.78.1-t8903926f7-gfdc1e9ca4 338 2025-03-02
diffoscope JSON 1.66.3-teae73f821-g63a2bbc8e71 219 2024-05-15
diffoscope JSON 1.41.69-te3cb98213-g38061656a57 166 2023-05-30
diffoscope JSON 1.40.0-t9bdaece3d-ge0ba590be3e 165 2023-04-29
diffoscope JSON 1.39.194-te3b2250e2-gaa32919ac3d 163 2023-04-23
diffoscope JSON 1.39.138-tcef0a474f-ga5346dcc26a 161 2023-04-14
diffoscope JSON 1.4.5-tb89c65304-gd3e0b420939 35 2021-03-15
diffoscope JSON 1.4.5-tb89c65304-gd3e0b420939 35 2021-03-05
com.teamdc.stephendiniz.autoaway Auto-Away diffoscope JSON 1.3.0 24 2021-03-15
com.templaro.opsiz.aka Androidomatic Keyer diffoscope JSON 1.0 10 2021-03-15
diffoscope JSON 1.0 10 2018-10-17
com.termux.gui Termux:GUI diffoscope JSON 0.1.6 7 2023-05-07
com.termux.styling Termux:Styling diffoscope JSON 0.32.0 32 2024-06-14
diffoscope JSON 0.31 31 2023-11-27
diffoscope JSON 0.17 17 2021-03-15
diffoscope JSON 0.16 16 2021-03-15
com.thehcj.quacker Quacker diffoscope JSON 3.5.1 300200213 2025-05-06
diffoscope JSON 3.5.1 300200212 2025-05-05
diffoscope JSON 3.5.1 300200211 2025-05-04
diffoscope JSON 3.5.0 300200203 2025-04-26
diffoscope JSON 3.5.0 300200202 2025-04-25
diffoscope JSON 3.5.0 300200201 2025-04-24
diffoscope JSON 3.3.1 300200105 2024-04-17
com.thehoick.evergreenwishlist Evergreen Wishlist diffoscope JSON 0.0.1 18 2021-03-15
diffoscope JSON 0.0.1 18 2018-10-17
com.theksmith.android.car_bus_interface Car Bus Interface diffoscope JSON 1.0 100 2021-03-15
diffoscope JSON 1.0 100 2018-10-17
com.thesis.yokatta Yokatta diffoscope JSON v0.3.4 4 2022-01-09
com.thesuncat.sudoku SUD💜KU diffoscope JSON 2.0.0 4 2024-02-21
com.thibaudperso.sonycamera TimeLapse diffoscope JSON 3.0.7 24 2021-03-15
diffoscope JSON 3.0.7 24 2021-03-11
diffoscope JSON 3.0.6 23 2021-03-15
diffoscope JSON 3.0.6 23 2019-12-22
com.tjEnterprises.phase10Counter Phase10Counter diffoscope JSON 3.2.0 23 2025-02-21
diffoscope JSON 3.1.1 22 2024-12-07
diffoscope JSON 3.1.0 21 2024-12-07
diffoscope JSON 3.0.1 20 2024-01-26
diffoscope JSON 3.0.0 19 2024-01-12
diffoscope JSON 2.0.1 18 2023-09-03
diffoscope JSON 1.4.7 14 2023-02-15
com.tkjelectronics.balanduino Balanduino diffoscope JSON 0.6.3-usb 1200063 2021-03-15
diffoscope JSON 0.6.3-usb 1200063 2018-10-17
com.tkton.wallet TkTon Wallet diffoscope JSON 1.2 120 2022-12-15
com.tmendes.dadosd DadosD diffoscope JSON 20160914_V4 4 2021-03-15
com.tnibler.cryptocam Cryptocam - encrypting camera app diffoscope JSON 2.3.1 17 2022-08-10
diffoscope JSON 1.1.3 5 2021-03-15
diffoscope JSON 1.1.3 5 2021-03-07
com.tobiaskuban.android.monthcalendarwidgetfoss Month Calendar Widget diffoscope JSON 1.2.0 5 2021-03-15
diffoscope JSON 1.2.0 5 2018-10-17
com.tomer.dbz.widget DBZ Battery Widget diffoscope JSON 1.6 5 2021-03-15
diffoscope JSON 1.6 5 2018-10-17
com.tomer.poke.notifier More for GO diffoscope JSON 1.5 19 2021-03-15
diffoscope JSON 1.5 19 2018-10-17
com.topjohnwu.magisk Magisk diffoscope JSON 28.1 28100 2025-03-06
diffoscope JSON 26.4 26400 2024-02-20
com.tortel.syslog SysLog diffoscope JSON 2.5.0 37 2024-01-27
diffoscope JSON 2.4.2 36 2023-09-18
diffoscope JSON 2.1.0 24 2021-03-15
diffoscope JSON 2.1.0 24 2018-10-17
com.traffar.a24game 24game diffoscope JSON 0.4 4 2021-03-15
diffoscope JSON 0.4 4 2018-10-17
com.traffar.game_of_life Game of Life diffoscope JSON 0.4 4 2021-03-15
diffoscope JSON 0.4 4 2018-10-17
com.traffar.pentago Pentago diffoscope JSON 0.2 2 2021-03-15
diffoscope JSON 0.2 2 2018-10-17
com.truchsess.send2car send2car diffoscope JSON 0.9 13 2021-04-04
com.tutpro.baresip.plus baresip+ diffoscope JSON 54.1.0 212 2025-07-15
diffoscope JSON 54.0.1 211 2025-06-20
diffoscope JSON 54.0.0 210 2025-06-16
diffoscope JSON 53.1.2 209 2025-06-09
diffoscope JSON 53.1.0 207 2025-06-06
diffoscope JSON 53.0.4 206 2025-06-05
diffoscope JSON 53.0.3 205 2025-06-05
diffoscope JSON 52.2.3 200 2025-05-13
diffoscope JSON 52.1.0 196 2025-05-12
diffoscope JSON 47.4.0 175 2024-05-16
diffoscope JSON 46.8.0 170 2024-03-18
diffoscope JSON 46.7.0 169 2024-03-09
diffoscope JSON 46.6.0 168 2024-02-29
diffoscope JSON 46.5.0 167 2024-01-30
diffoscope JSON 46.4.0 166 2024-01-05
diffoscope JSON 46.3.0 165 2023-11-26
diffoscope JSON 42.0.0 144 2023-04-20
diffoscope JSON 41.4.0 143 2023-04-17
diffoscope JSON 41.2.3 140 2023-04-11
diffoscope JSON 41.2.2 139 2023-04-08
diffoscope JSON 41.2.0 137 2023-04-06
diffoscope JSON 41.1.2 136 2023-04-03
diffoscope JSON 39.2.0 129 2023-03-06
diffoscope JSON 39.0.0 127 2023-02-25
diffoscope JSON 38.2.0 126 2023-02-20
diffoscope JSON 38.1.2 125 2023-02-15
diffoscope JSON 37.4.0 121 2023-01-09
diffoscope JSON 37.3.1 120 2022-12-18
diffoscope JSON 37.2.0 117 2022-12-16
diffoscope JSON 37.1.3 116 2022-11-05
diffoscope JSON 34.2.0 105 2022-08-09
diffoscope JSON 15.0.0 35 2021-03-16
diffoscope JSON 14.2.0 34 2021-03-15
diffoscope JSON 14.2.0 34 2021-03-06
com.twoeightnine.root.xvii xvii messenger for vk diffoscope JSON 6.1.9 194 2022-12-17
diffoscope JSON 6.1.8 193 2022-03-11
com.u2fa.secur Secur: Cross-platform 2FA client diffoscope JSON 1.0.1 5 2021-03-15
diffoscope JSON 1.0.1 5 2021-03-06
com.unwind.networkmonitor Network Scanner diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.unwrappedapps.android.wallpaper.creative Truly Creative live wallpaper diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.utyf.pmetro pMetro diffoscope JSON 0.0.18 112 2021-03-15
diffoscope JSON 0.0.18 112 2018-10-17
com.veken0m.bitcoinium Bitcoinium Prime diffoscope JSON 1.8.3 48 2021-03-15
diffoscope JSON 1.8.3 48 2018-10-17
com.viper.simplert SimpleRT diffoscope JSON 1.1.1 2 2022-08-16
diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
com.vladrip.drgassistant Deep Rock Galactic Assistant diffoscope JSON 1.1 4 2023-02-16
diffoscope JSON 1.0.2 3 2022-11-08
diffoscope JSON 1.0.1 2 2022-08-10
com.volosyukivan WiFiKeyboard diffoscope JSON 2.3.5 30 2021-03-15
diffoscope JSON 2.3.5 30 2018-10-17
com.vonglasow.michael.qz Qz diffoscope JSON 2.2.0 20200 2021-03-15
diffoscope JSON 2.2.0 20200 2021-03-08
diffoscope JSON 2.1.0 20100 2021-03-15
diffoscope JSON 2.1.0 20100 2019-01-16
com.vuze.android.remote Vuze Remote diffoscope JSON 2.6.1 82 2021-03-15
com.w2sv.filenavigator File Navigator diffoscope JSON 0.2.5 13 2025-02-25
diffoscope JSON 0.2.3 11 2025-01-18
com.w2sv.wifiwidget WiFi Widget diffoscope JSON 1.6.0.1 62 2024-12-07
com.wa2c.android.cifsdocumentsprovider CIFS Documents Provider diffoscope JSON 2.2.0 27 2024-06-14
diffoscope JSON 2.1.1 26 2024-02-26
diffoscope JSON 2.1.0 25 2024-01-23
diffoscope JSON 2.0.2 24 2023-12-17
diffoscope JSON 1.8.0 20 2023-08-30
diffoscope JSON 1.6.0 16 2022-08-12
com.wangjinli.carvita CarVita diffoscope JSON 1.0.1 6 2025-07-15
com.watabou.pixeldungeon Pixel Dungeon diffoscope JSON 1.9.1 74 2021-03-15
diffoscope JSON 1.9.1 74 2018-10-17
com.weicheng.taipeiyoubikeoffline Taipei Youbike Offline diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
com.willianveiga.countdowntimer Countdown Timer diffoscope JSON 1.2.0 4 2021-03-15
diffoscope JSON 1.2.0 4 2018-10-17
com.windscribe.vpn Windscribe diffoscope JSON 3.75 1298 2024-02-04
diffoscope JSON 3.74 1210 2023-12-03
com.wire Wire • Secure Messenger diffoscope JSON 4.13.0 100095358 2025-05-30
diffoscope JSON 4.12.2 100089904 2025-05-21
diffoscope JSON 4.12.1 100087596 2025-04-28
diffoscope JSON 4.11.0 100083279 2025-04-20
diffoscope JSON 4.10.2 100073485 2025-03-22
diffoscope JSON 4.10.0 100058708 2025-01-20
diffoscope JSON 4.9.0-42652 100042652 2024-12-07
diffoscope JSON 4.8.5-29411-fdroid 100029411 2024-12-10
diffoscope JSON 4.8.5-29411-fdroid 100029411 2024-12-09
com.woefe.shoppinglist Shopping List diffoscope JSON 0.11.0 12 2021-03-15
diffoscope JSON 0.11.0 12 2019-12-23
com.workingagenda.fissure Fissure diffoscope JSON 0.3.2 5 2021-03-15
com.wuxialearn.wuxialearn Wuxia Learn - Learn Chinese diffoscope JSON 1.4.7 243 2025-04-16
diffoscope JSON 1.4.7 242 2025-04-15
diffoscope JSON 1.4.7 241 2025-04-11
diffoscope JSON 1.4.6 233 2025-03-27
diffoscope JSON 1.4.6 232 2025-03-26
diffoscope JSON 1.4.6 231 2025-03-25
diffoscope JSON 1.3.3 163 2025-03-01
diffoscope JSON 1.3.3 162 2025-02-01
diffoscope JSON 1.3.3 161 2025-01-31
diffoscope JSON 1.3.0 143 2025-02-27
diffoscope JSON 1.3.0 142 2025-01-20
diffoscope JSON 1.3.0 141 2025-01-17
diffoscope JSON 1.2.4 133 2025-03-04
diffoscope JSON 1.2.4 132 2025-03-02
diffoscope JSON 1.2.4 131 2025-01-21
com.xabber.android Xabber diffoscope JSON 2.6.6.644-open 644 2021-03-15
diffoscope JSON 2.6.6.644-open 644 2019-12-21
com.xargsgrep.portknocker Port Knocker diffoscope JSON 1.0.13 14 2022-01-12
diffoscope JSON 1.0.11 12 2021-03-15
com.xatik.app.droiddraw.client Droid Draw diffoscope JSON 1.0.0 4 2021-03-15
diffoscope JSON 1.0.0 4 2018-10-17
com.xenris.liquidwarsos Liquid Wars OS diffoscope JSON 1.42 11 2021-03-15
diffoscope JSON 1.42 11 2018-10-17
com.xperia64.timidityae Timidity AE diffoscope JSON 3.0.6 96 2024-12-10
com.yasfa.views YASFA diffoscope JSON 3.0 3 2021-03-15
diffoscope JSON 3.0 3 2018-10-17
com.yassirh.digitalocean DO Swimmer diffoscope JSON 3.0.1 32 2021-03-15
diffoscope JSON 3.0.1 32 2020-06-11
diffoscope JSON 2.4-SNAPSHOT 31 2021-03-15
diffoscope JSON 2.4-SNAPSHOT 31 2018-10-17
com.yubico.yubioath Yubico Authenticator diffoscope JSON 7.2.2 702024 2025-04-18
diffoscope JSON 7.2.2 702022 2025-04-17
diffoscope JSON 7.2.2 702021 2025-04-16
diffoscope JSON 7.2.0 702004 2025-04-15
diffoscope JSON 7.2.0 702002 2025-04-11
diffoscope JSON 7.2.0 702001 2025-04-11
diffoscope JSON 1.2.1 34 2021-03-15
diffoscope JSON 1.1.0 29 2021-03-15
com.zoffcc.applications.undereat UnderEat diffoscope JSON 1.0.11 10011 2025-07-16
diffoscope JSON 1.0.8 10008 2025-07-15
com.zola.bmi BMI Calculator diffoscope JSON 4.0.2 402 2021-03-15
diffoscope JSON 4.0.2 402 2021-03-10
diffoscope JSON 4.0.0 400 2021-03-15
diffoscope JSON 4.0.0 400 2019-12-23
diffoscope JSON 3.0.1 301 2021-03-15
diffoscope JSON 3.0.1 301 2018-10-17
com.zorinos.zorin_connect Zorin Connect diffoscope JSON 1.33.2 13302 2025-03-25
diffoscope JSON 1.33.1 13301 2025-03-13
diffoscope JSON 1.32.11 13211 2025-03-10
diffoscope JSON 1.32.9 13209 2024-12-02
diffoscope JSON 1.23.2 12302 2023-04-12
diffoscope JSON 1.22.3 12203 2023-03-05
diffoscope JSON 1.19.1 11910 2022-08-09
diffoscope JSON 1.17.0 11700 2022-01-12
diffoscope JSON 1.14.2 11422 2021-03-15
diffoscope JSON 1.14.2 11422 2021-03-11
cs4295.memecreator Meme Creator diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
csci567.squeez Squeez diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
cx.mccormick.pddroidparty PdDroid Party diffoscope JSON 0.3.0 2 2021-06-01
cx.ring Jami diffoscope JSON 20250718-01 463 2025-07-26
diffoscope JSON 20250708-01 462 2025-07-17
diffoscope JSON 20250626-01 461 2025-07-15
diffoscope JSON 20250605-01 460 2025-06-13
diffoscope JSON 20250522-01 459 2025-05-30
diffoscope JSON 20250513-01 458 2025-05-19
diffoscope JSON 20250508-01 457 2025-05-15
diffoscope JSON 20250410-01 454 2025-04-20
diffoscope JSON 20250331-01 453 2025-04-10
diffoscope JSON 20250314-01 451 2025-03-22
diffoscope JSON 20250307-01 449 2025-03-13
diffoscope JSON 20250205-01 442 2025-02-23
diffoscope JSON 20250117-01 440 2025-02-02
diffoscope JSON 20241126-01 436 2024-12-04
diffoscope JSON 20241112-01 435 2024-12-07
diffoscope JSON 20241105-01 434 2024-12-07
diffoscope JSON 20230502-01 368 2023-05-05
diffoscope JSON 20230424-01 367 2023-04-30
diffoscope JSON 20230421-01 366 2023-04-27
cxa.gridwallpaper Limitless grid diffoscope JSON 1.4 8 2021-03-15
diffoscope JSON 1.4 8 2018-10-17
cxa.lineswallpaper Blurred Lines diffoscope JSON 1.4 12 2021-03-15
diffoscope JSON 1.4 12 2018-10-17
cz.hejl.chesswalk Chess Walk diffoscope JSON 1.5.2 9 2021-03-15
diffoscope JSON 1.5.2 9 2018-10-17
cz.mendelu.xmarik.train_manager hJOP Driver diffoscope JSON 2.3 34 2025-07-26
diffoscope JSON 2.1 32 2025-03-22
diffoscope JSON 2.0 31 2025-02-25
diffoscope JSON 1.19 30 2025-02-22
cz.slaby.dpc DPC diffoscope JSON 1.4.0 5 2024-02-26
diffoscope JSON 1.3.0 4 2024-02-20
cz.vitSkalicky.klavesnice Czech Diacritic Keyboard diffoscope JSON 1.0 2 2021-03-15
diffoscope JSON 1.0 2 2019-12-22
daniel_32.flexiblewallpaper Flexible Wallpaper diffoscope JSON 1.1 2 2021-03-15
de.antonarnold.android.xoverrideheadphonejackdetection XOverrideHeadphoneJackDetection diffoscope JSON 1.5 5 2021-03-15
diffoscope JSON 1.5 5 2019-12-20
diffoscope JSON 1.3 3 2021-03-15
diffoscope JSON 1.3 3 2019-01-16
de.arnefeil.bewegungsmelder Bewegungsmelder diffoscope JSON 2.0.2 140630 2021-03-15
diffoscope JSON 2.0.2 140630 2018-10-17
de.badaix.snapcast Snapcast - multi-room audio in perfect sync diffoscope JSON 0.29.0.2 2902 2025-04-10
diffoscope JSON 0.29.0.1 2901 2024-12-10
diffoscope JSON 0.27.0.0 2700 2023-02-19
diffoscope JSON 0.24.0.0 2400 2021-03-15
diffoscope JSON 0.24.0.0 2400 2021-03-12
de.bahnvorhersage.app Bahn-Vorhersage diffoscope JSON 0.4.6 10 2025-07-16
diffoscope JSON 0.4.5 9 2025-05-15
diffoscope JSON 0.4.4 8 2025-05-04
diffoscope JSON 0.4.3 7 2025-04-24
diffoscope JSON 0.4.2 6 2025-04-15
diffoscope JSON 0.4.1 5 2025-04-10
diffoscope JSON 0.4 4 2025-03-25
diffoscope JSON 0.3 3 2025-03-18
de.baumann.quitsmoking Quit Smoking diffoscope JSON 2.5 22 2021-03-15
diffoscope JSON 2.5 22 2018-10-17
diffoscope JSON 1.4.1 11 2021-03-15
de.binary_kitchen.doorlock_app Binary Kitchen Doorlock diffoscope JSON 2.5 8 2021-03-15
diffoscope JSON 2.5 8 2018-12-06
de.blinkt.openvpn OpenVPN for Android diffoscope JSON 0.7.61 216 2025-05-04
diffoscope JSON 0.7.59 214 2025-04-24
diffoscope JSON 0.7.58 213 2025-04-15
diffoscope JSON 0.7.57 212 2025-04-11
diffoscope JSON 0.7.54 209 2024-12-10
diffoscope JSON 0.7.51 206 2023-12-04
diffoscope JSON 0.7.50 205 2023-11-24
diffoscope JSON 0.7.49 204 2024-06-14
diffoscope JSON 0.7.43 198 2022-12-19
diffoscope JSON 0.7.38 193 2022-08-10
diffoscope JSON 0.7.22 176 2021-05-31
diffoscope JSON 0.7.15 168 2021-03-15
diffoscope JSON 0.7.15 168 2020-06-11
diffoscope JSON 0.7.6 159 2021-03-15
diffoscope JSON 0.7.6 159 2018-12-07
de.blocklink.pigrid PiGrid Companion diffoscope JSON 1.4 5 2021-03-15
diffoscope JSON 1.4 5 2019-01-16
diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-12-06
de.box2code.matoid Mat-O-Id diffoscope JSON 1.0.0 2 2024-05-11
de.com.quaap.primary Schule diffoscope JSON 0.3.3.de3 331 2021-03-15
diffoscope JSON 0.3.3.de3 331 2021-03-12
de.cryptobitch.muelli.barcodegen Barcodegen diffoscope JSON 0.2 2 2021-03-15
de.cryptobitch.muelli.vouchercalc Voucher Calc diffoscope JSON 0.3 3 2021-03-15
diffoscope JSON 0.3 3 2018-10-17
de.danoeh.antennapod AntennaPod diffoscope JSON 3.6.1 3060195 2025-01-18
diffoscope JSON 3.6.0 3060095 2025-01-21
diffoscope JSON 3.5.0 3050095 2024-12-10
diffoscope JSON 3.4.0 3040095 2024-06-14
diffoscope JSON 3.3.2 3030295 2024-04-05
diffoscope JSON 3.2.0 3020095 2023-12-18
diffoscope JSON 3.1.2 3010295 2023-11-26
diffoscope JSON 3.0.2 3000295 2023-05-10
diffoscope JSON 2.7.1 2070195 2022-11-06
diffoscope JSON 2.2.1 2020195 2021-05-28
diffoscope JSON 2.1.4 2010495 2021-03-15
diffoscope JSON 2.1.4 2010495 2021-03-06
diffoscope JSON 1.8.1 1080195 2021-03-15
diffoscope JSON 1.8.1 1080195 2020-06-11
diffoscope JSON 1.7.1 1070195 2021-03-15
diffoscope JSON 1.7.1 1070195 2018-12-06
diffoscope JSON 1.6.2.3 1060203 2021-03-15
diffoscope JSON 1.6.2.3 1060203 2018-10-17
de.devmil.muzei.bingimageofthedayartsource Muzei - Bing Image of the Day diffoscope JSON 2.3.2 18 2025-07-26
diffoscope JSON 2.0 9 2021-03-15
diffoscope JSON 2.0 9 2021-03-10
diffoscope JSON 1.6 7 2021-03-15
diffoscope JSON 1.6 7 2019-01-16
de.devmil.paperlaunch PaperLaunch: Side launcher diffoscope JSON 2.0.0 19 2025-07-16
de.digisocken.stop_o_moto Stop-o-Moto diffoscope JSON 0.95 95 2021-03-15
diffoscope JSON 0.95 95 2019-04-06
de.doen1el.calibreWebCompanion Calibre-Web-Companion diffoscope JSON 1.7.0 203 2025-07-22
diffoscope JSON 1.6.0 133 2025-05-08
de.dotwee.micropinner MicroPinner diffoscope JSON v2.0.1 26 2021-03-15
diffoscope JSON v2.0.1 26 2018-10-17
de.drhoffmannsoft.pizza Pizza Cost diffoscope JSON 1.05-11 11 2021-03-15
diffoscope JSON 1.05-11 11 2021-03-07
de.drhoffmannsoftware TSCH_BYL diffoscope JSON 1.16-11 11 2021-03-15
diffoscope JSON 1.16-11 11 2021-03-09
diffoscope JSON 1.16-7 7 2021-03-15
de.drhoffmannsoftware.xearth Xearth diffoscope JSON 2015.10.09.01 2015100901 2021-03-15
diffoscope JSON 2015.10.09.01 2015100901 2018-10-17
de.freehamburger Hamburger diffoscope JSON 1.5.1 8 2023-05-08
diffoscope JSON 1.5 7 2023-04-30
diffoscope JSON 1.4 6 2023-02-16
diffoscope JSON 1.3 5 2022-12-15
diffoscope JSON 1.2 4 2022-08-15
diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2021-03-08
de.hfu.funfpunktnull Studiportal diffoscope JSON 2.6.0 22 2021-03-15
de.hirtenstrasse.michael.lnkshortener LnkShortener diffoscope JSON 1.1.2 7 2021-03-15
diffoscope JSON 1.1.2 7 2018-10-17
diffoscope JSON 1.1.0 5 2021-03-15
de.hoffmannsgimmicks Meeting Cost Clock diffoscope JSON 1.08-10 10 2021-03-15
de.hoffmannsgimmickstaupunkt Dew Point diffoscope JSON 1.06-21 21 2021-03-15
diffoscope JSON 1.06-21 21 2021-03-09
diffoscope JSON 1.06-16 16 2021-03-15
de.jbservices.nc_passwords_app NC Passwords diffoscope JSON 23.2.2 24 2024-02-22
diffoscope JSON 21.4.0 18 2021-05-31
diffoscope JSON 21.2.4 17 2021-04-02
diffoscope JSON 21.2.3 16 2021-03-15
diffoscope JSON 21.2.3 16 2021-03-14
de.jepfa.yapm ANOTHERpass diffoscope JSON 2.2.3 202003 2025-07-26
diffoscope JSON 2.2.2 202002 2025-05-23
diffoscope JSON 2.2.1 202001 2025-04-30
diffoscope JSON 2.2.0 202000 2025-04-10
diffoscope JSON 2.1.1 201001 2025-02-25
diffoscope JSON 2.1.0 201000 2025-02-22
diffoscope JSON 2.0.4 200004 2025-01-21
diffoscope JSON 2.0.3 200003 2024-12-10
diffoscope JSON 2.0.2 200002 2024-12-07
diffoscope JSON 2.0.0 200000 2024-12-08
diffoscope JSON 1.9.4 109004 2024-06-14
diffoscope JSON 1.9.3 109003 2024-05-10
diffoscope JSON 1.9.2 109002 2024-04-06
diffoscope JSON 1.9.1 109001 2024-01-15
diffoscope JSON 1.9.0 109000 2024-01-07
diffoscope JSON 1.8.2 108002 2023-11-25
diffoscope JSON 1.8.1 108001 2023-07-10
diffoscope JSON 1.8.0 108000 2023-04-15
diffoscope JSON 1.7.3 107003 2023-02-16
diffoscope JSON 1.7.2 107002 2022-12-19
diffoscope JSON 1.7.1 107001 2022-11-05
de.jugendhacker.xmppadmin XMPP Admin diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2019-09-12
de.jurihock.voicesmith Voicesmith diffoscope JSON 2.6 12 2021-03-15
diffoscope JSON 2.6 12 2018-10-17
de.k3b.android.contentproviderhelper Content Provider Helper diffoscope JSON 1.3.0 3 2021-03-15
diffoscope JSON 1.3.0 3 2018-10-17
de.k4ever.k4android k4android diffoscope JSON 1.3 10 2021-03-15
diffoscope JSON 1.3 10 2018-10-17
de.keplerchemnitz.kepler_app Kepler-App diffoscope JSON 2.16.0 84 2025-06-23
diffoscope JSON 2.12.0 79 2025-04-12
diffoscope JSON 2.9.2 75 2025-01-20
diffoscope JSON 2.9.0 73 2025-01-18
diffoscope JSON 2.8.1 72 2024-12-11
diffoscope JSON 2.7.1 70 2024-12-11
diffoscope JSON 2.7.1 70 2024-12-10
de.kromke.andreas.mediascanner Classical Music Scanner diffoscope JSON 1.8 21 2023-12-18
diffoscope JSON 1.7.2 20 2023-11-24
diffoscope JSON 1.7.1 19 2024-06-14
diffoscope JSON 1.7 18 2022-08-15
diffoscope JSON 1.5 15 2021-03-15
diffoscope JSON 1.5 15 2021-03-10
diffoscope JSON 1.4 13 2021-03-15
diffoscope JSON 1.4 13 2020-01-25
diffoscope JSON 1.3.1 12 2021-03-15
diffoscope JSON 1.3.1 12 2019-12-21
de.kromke.andreas.musictagger Classical Music Tagger diffoscope JSON 1.9.6 32 2024-12-08
diffoscope JSON 1.9.5 31 2024-01-19
diffoscope JSON 1.9.4 30 2024-01-12
diffoscope JSON 1.9.3 29 2023-11-24
diffoscope JSON 1.9.2 28 2023-10-07
diffoscope JSON 1.9 26 2023-09-20
diffoscope JSON 1.6 22 2021-05-29
diffoscope JSON 1.5 21 2021-03-15
diffoscope JSON 1.5 21 2021-03-10
diffoscope JSON 1.4.1 19 2021-03-15
diffoscope JSON 1.4.1 19 2020-06-11
diffoscope JSON 1.4 18 2021-03-15
diffoscope JSON 1.4 18 2020-05-21
diffoscope JSON 1.2.1 14 2021-03-15
diffoscope JSON 1.2.1 14 2019-12-21
diffoscope JSON 1.0.1 9 2021-03-15
diffoscope JSON 1.0.1 9 2019-01-16
de.kromke.andreas.opus1musicplayer Opus 1 Music Player diffoscope JSON 2.64 75 2024-12-05
diffoscope JSON 2.63.2 74 2024-12-07
diffoscope JSON 2.63.1 73 2024-02-15
diffoscope JSON 2.62 71 2023-12-31
diffoscope JSON 2.61.3 70 2023-11-25
diffoscope JSON 2.61.2 69 2023-09-01
diffoscope JSON 2.60.3 63 2022-08-12
diffoscope JSON 2.50 60 2021-05-28
diffoscope JSON 2.40.1 59 2021-03-15
diffoscope JSON 2.40.1 59 2021-03-06
de.kromke.andreas.safmediascanner SAF Media Scanner diffoscope JSON 1.8.4 14 2024-12-08
diffoscope JSON 1.8.2 12 2023-12-02
diffoscope JSON 1.8 10 2022-08-15
de.kromke.andreas.unpopmusicplayerfree Unpopular Music Player diffoscope JSON 2.83 63 2024-12-07
diffoscope JSON 2.82 61 2023-12-23
diffoscope JSON 2.81 60 2023-12-18
diffoscope JSON 2.80.6 59 2023-10-24
diffoscope JSON 2.80.5 58 2023-10-03
diffoscope JSON 2.80.2 55 2022-08-12
diffoscope JSON 2.62 50 2021-05-29
diffoscope JSON 2.50.1 44 2021-03-15
diffoscope JSON 2.50.1 44 2021-03-10
diffoscope JSON 2.30 40 2021-03-15
diffoscope JSON 2.30 40 2020-05-21
diffoscope JSON 2.20 39 2021-03-15
diffoscope JSON 2.20 39 2020-01-24
diffoscope JSON 2.11.3 38 2021-03-15
diffoscope JSON 2.11.3 38 2019-12-20
diffoscope JSON 1.50.1 27 2021-03-15
diffoscope JSON 1.50.1 27 2019-01-16
diffoscope JSON 1.44.3 25 2021-03-15
diffoscope JSON 1.44.3 25 2018-12-06
diffoscope JSON 1.33 16 2021-03-15
diffoscope JSON 1.33 16 2018-10-17
diffoscope JSON 1.31 14 2021-03-15
diffoscope JSON 1.31 14 2018-10-17
diffoscope JSON 1.30.1 13 2021-03-15
diffoscope JSON 1.30.1 13 2018-10-17
diffoscope JSON 1.04 8 2021-03-15
diffoscope JSON 1.04 8 2018-10-17
diffoscope JSON 1.03 7 2021-03-15
de.ktran.anno1404warenrechner ANNO 1404 - Calculator diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
de.live.gdev.cherrymusic Cherry diffoscope JSON 1.3.10 13 2021-03-15
diffoscope JSON 1.3.10 13 2018-10-17
diffoscope JSON 1.3.0 8 2021-03-15
diffoscope JSON 1.3.0 8 2018-10-17
de.live.gdev.timetracker Kimai TimeTracker diffoscope JSON 1.3.11 24 2021-03-15
diffoscope JSON 1.3.11 24 2018-10-17
diffoscope JSON 1.3.0 13 2021-03-15
diffoscope JSON 1.3.0 13 2018-10-17
de.lukasneugebauer.nextcloudcookbook Nextcloud Cookbook diffoscope JSON 0.24.3 55 2025-05-04
diffoscope JSON 0.24.2 54 2025-04-10
diffoscope JSON 0.24.0 50 2025-02-02
diffoscope JSON 0.15.0 37 2024-06-14
diffoscope JSON 0.14.6 36 2024-02-07
diffoscope JSON 0.14.2 31 2023-10-19
de.mangelow.balance Balance diffoscope JSON 0.12 3 2021-03-15
de.mangelow.debdroid debDroid diffoscope JSON 0.15 5 2021-03-15
diffoscope JSON 0.13 4 2021-03-15
de.mangelow.slideitloud SlideItLoud diffoscope JSON 1.13 7 2021-03-15
de.mangelow.syncwifi SyncWifi diffoscope JSON 2.15 17 2021-03-15
de.mangelow.throughput Throughput diffoscope JSON 0.76 15 2021-03-15
de.mathema.privacyblur PrivacyBlur diffoscope JSON 2.1.6-foss 42 2022-03-12
diffoscope JSON 2.1.3-foss 39 2022-01-10
de.monde_diplomatique.android.app.free LMd - Le Monde diplomatique DE diffoscope JSON 2.3.1 20301900 2025-05-27
diffoscope JSON 2.3.0 20300900 2025-05-08
de.naturalnet.mirwtfapp WTF‽ (The MirOS Project) diffoscope JSON 1.1.3 9 2021-03-15
diffoscope JSON 1.1.3 9 2018-10-17
diffoscope JSON 1.1.2 8 2021-03-15
diffoscope JSON 1.1.2 8 2018-10-17
de.neuwirthinformatik.alexander.mtuo mTUO diffoscope JSON 6.5.1-r4 32 2024-05-10
de.nodomain.tobihille.seniorlauncher Senior Launcher diffoscope JSON 1.7 7000 2021-03-15
diffoscope JSON 1.7 7000 2019-01-16
de.nulide.findmydevice Find My Device (FMD) diffoscope JSON 0.11.0 34 2025-02-21
diffoscope JSON 0.10.0 33 2025-02-02
diffoscope JSON 0.9.1 32 2024-12-07
diffoscope JSON 0.9.0 31 2024-12-07
diffoscope JSON 0.8.0 30 2024-12-03
diffoscope JSON 0.5.0 25 2024-06-14
diffoscope JSON 0.4.0 24 2024-03-04
diffoscope JSON 0.3.2 23 2023-09-07
diffoscope JSON 0.3.1 22 2023-09-04
diffoscope JSON 0.2.9 20 2023-05-04
de.onyxbits.remotekeyboard Remote Keyboard diffoscope JSON 1.7 8 2021-03-15
diffoscope JSON 1.7 8 2018-10-17
de.onyxbits.sensorreadout Sensor Readout diffoscope JSON 2.4 8 2021-03-15
de.phoenixstudios.pc_dimmer PC_DIMMER diffoscope JSON 1.4 5 2021-03-15
diffoscope JSON 1.4 5 2018-10-17
de.pinyto.exalteddicer Exalted Dicer diffoscope JSON 2.2 4 2021-03-15
diffoscope JSON 2.2 4 2018-10-17
de.ptrlx.oneshot OneShot diffoscope JSON 1.1.1 111 2024-06-14
de.quantumphysique.trale trale diffoscope JSON 0.11.2 313 2025-07-27
diffoscope JSON 0.11.2 311 2025-07-26
diffoscope JSON 0.11.0 293 2025-04-15
diffoscope JSON 0.10.1 283 2025-03-18
diffoscope JSON 0.10.1 282 2025-03-17
diffoscope JSON 0.10.1 281 2025-03-16
diffoscope JSON 0.9.3 263 2025-03-15
diffoscope JSON 0.9.3 262 2025-03-14
diffoscope JSON 0.9.3 261 2025-03-13
diffoscope JSON 0.9.2 253 2025-03-12
diffoscope JSON 0.9.2 252 2025-03-11
diffoscope JSON 0.9.2 251 2025-03-10
diffoscope JSON 0.9.0 233 2025-01-21
diffoscope JSON 0.9.0 232 2025-01-20
diffoscope JSON 0.9.0 231 2025-01-17
diffoscope JSON 0.8.1 221 2024-12-11
de.retujo.bierverkostung Bierverkostung diffoscope JSON 1.2.1 4 2021-03-15
diffoscope JSON 1.2.1 4 2019-01-16
diffoscope JSON 1.1.0 2 2021-03-15
de.salomax.currencies Currencies: Exchange Rate Calculator diffoscope JSON 1.22.6 12206 2025-03-27
diffoscope JSON 1.22.5 12205 2025-04-22
diffoscope JSON 1.22.0 12200 2024-06-14
diffoscope JSON 1.17.4 11704 2022-11-06
diffoscope JSON 1.17.0 11700 2022-08-11
diffoscope JSON 1.5.0 10500 2021-05-30
diffoscope JSON 1.2.0 10200 2021-03-15
diffoscope JSON 1.2.0 10200 2021-03-07
de.seemoo.at_tracking_detection AirGuard - AirTag protection diffoscope JSON 2.4.1 51 2025-03-25
diffoscope JSON 2.4.0 50 2025-02-02
diffoscope JSON 2.1.1 39 2023-11-25
diffoscope JSON 2.1 38 2024-06-14
de.sesu8642.feudaltactics Feudal Tactics diffoscope JSON 1.3.1 11 2024-12-10
diffoscope JSON 1.3.0 10 2024-12-07
diffoscope JSON 1.0 1 2022-11-08
de.sigfood Sigfood diffoscope JSON 2.7.1 26 2021-03-15
de.simplestatswidget SimpleStatsWidget diffoscope JSON 1.2.1 121 2021-03-15
diffoscope JSON 1.2.1 121 2019-11-20
diffoscope JSON 1.0.3 103 2021-03-15
diffoscope JSON 1.0.3 103 2018-10-17
diffoscope JSON 1.0.2 102 2021-03-15
diffoscope JSON 1.0.2 102 2018-10-17
de.spiritcroc.riotx SchildiChat diffoscope JSON 1.6.12.sc77 40101274 2024-03-02
diffoscope JSON 1.6.10.sc76 40101264 2024-02-26
diffoscope JSON 1.6.10.sc75 40101254 2024-02-20
diffoscope JSON 1.1.0.sc29 40100430 2021-03-05
de.srlabs.snoopsnitch SnoopSnitch diffoscope JSON 1.0.3 17 2021-03-15
diffoscope JSON 1.0.3 17 2018-10-17
de.steinpfeffer.rdt Rule of Three diffoscope JSON 1.0.1 1 2021-03-15
diffoscope JSON 1.0.1 1 2018-10-17
de.sudoq SudoQ diffoscope JSON 2.0.7 41 2022-08-15
diffoscope JSON 1.0.7 11 2021-03-15
diffoscope JSON 1.0.7 11 2018-10-17
de.tadris.fitness FitoTrack diffoscope JSON 15.4 1540 2023-12-03
diffoscope JSON 15.3 1530 2023-09-11
diffoscope JSON 14.1 1410 2022-11-08
diffoscope JSON 14.0 1400 2022-08-14
diffoscope JSON 12.0 1200 2021-06-01
diffoscope JSON 11.0 1100 2021-04-02
diffoscope JSON 10.2 1020 2021-03-15
diffoscope JSON 10.2 1020 2021-03-07
de.tap.easy_xkcd Easy Xkcd diffoscope JSON 8.4 193 2023-10-04
diffoscope JSON 8.2.1 190 2023-02-16
diffoscope JSON 7.3.6 163 2021-03-15
diffoscope JSON 7.3.6 163 2019-12-21
diffoscope JSON 6.0.1 140 2021-03-15
diffoscope JSON 6.0.1 140 2018-10-17
diffoscope JSON 5.3.9 138 2021-03-15
diffoscope JSON 5.3.9 138 2018-10-17
de.taz.android.app.free taz diffoscope JSON 1.11.2 11102900 2025-07-22
diffoscope JSON 1.11.1 11101900 2025-05-27
diffoscope JSON 1.11.0 11100900 2025-04-15
diffoscope JSON 1.10.2 11002900 2025-03-03
diffoscope JSON 1.10.1 11001900 2025-03-02
diffoscope JSON 1.9.3 10903900 2024-12-14
diffoscope JSON 1.9.0 10900900 2024-03-10
diffoscope JSON 1.2.2 10202900 2021-03-15
diffoscope JSON 1.2.2 10202900 2021-03-09
de.tobiasbielefeld.solitaire Simple Solitaire Collection diffoscope JSON 3.7.2 48 2021-03-15
diffoscope JSON 3.7.2 48 2018-10-17
diffoscope JSON 3.3.5 34 2021-03-15
diffoscope JSON 3.3.5 34 2018-10-17
diffoscope JSON 3.3.4 33 2021-03-15
diffoscope JSON 3.3.4 33 2018-10-17
de.toshsoft.tsvnc TSVNC diffoscope JSON 0.7.6 21 2021-03-15
diffoscope JSON 0.7.6 21 2021-03-08
de.tu_chemnitz.etit.sse.openstop OpenStop diffoscope JSON 0.8.4 23 2025-06-09
de.tu_darmstadt.seemoo.HardWhere HardWhere diffoscope JSON 0.1 1 2022-08-09
de.tutao.calendar Tuta Calendar diffoscope JSON 299.250715.0 157 2025-07-22
diffoscope JSON 296.250709.0 154 2025-07-17
diffoscope JSON 293.250704.0 150 2025-07-16
diffoscope JSON 293.250624.0 143 2025-07-15
diffoscope JSON 287.250527.0 133 2025-06-04
diffoscope JSON 277.250414.1 115 2025-04-24
diffoscope JSON 277.250409.0 112 2025-04-15
diffoscope JSON 275.250326.0 109 2025-04-11
diffoscope JSON 275.250324.1 108 2025-04-11
diffoscope JSON 274.250312.0 102 2025-03-18
diffoscope JSON 271.250227.0 98 2025-03-10
diffoscope JSON 271.250224.0 97 2025-03-03
diffoscope JSON 267.250206.0 91 2025-02-23
diffoscope JSON 266.250202.0 88 2025-02-21
diffoscope JSON 261.250116.0 76 2025-02-01
diffoscope JSON 251.241113.0 49 2024-12-18
diffoscope JSON 251.241113.0 49 2024-12-17
diffoscope JSON 251.241108.0 47 2024-12-11
diffoscope JSON 250.241025.0 44 2024-12-14
de.tutao.tutanota Tuta Mail diffoscope JSON 299.250715.0 396517 2025-07-22
diffoscope JSON 296.250709.0 396514 2025-07-18
diffoscope JSON 293.250704.0 396510 2025-07-17
diffoscope JSON 293.250630.0 396506 2025-07-16
diffoscope JSON 293.250624.0 396504 2025-07-15
diffoscope JSON 287.250523.0 396493 2025-06-04
diffoscope JSON 284.250513.1 396488 2025-05-19
diffoscope JSON 277.250414.1 396476 2025-04-24
diffoscope JSON 277.250409.0 396473 2025-04-16
diffoscope JSON 275.250326.0 396470 2025-04-15
diffoscope JSON 275.250324.1 396469 2025-04-11
diffoscope JSON 274.250312.0 396463 2025-03-18
diffoscope JSON 271.250227.0 396459 2025-03-10
diffoscope JSON 271.250224.0 396458 2025-03-03
diffoscope JSON 270.250219.0 396456 2025-02-27
diffoscope JSON 267.250206.0 396452 2025-02-26
diffoscope JSON 266.250202.0 396449 2025-02-23
diffoscope JSON 266.250131.0 396448 2025-02-21
diffoscope JSON 259.241220.0 396430 2025-01-21
diffoscope JSON 253.241126.2 396418 2024-12-17
diffoscope JSON 252.241122.0 396415 2024-12-14
diffoscope JSON 251.241112.0 396409 2024-12-11
diffoscope JSON 227.240502.0 396337 2024-06-14
diffoscope JSON 218.240227.0 396310 2024-03-02
diffoscope JSON 218.240219.0 396307 2024-02-25
diffoscope JSON 3.122.4 396304 2024-02-15
diffoscope JSON 3.73.1 373010 2021-03-15
diffoscope JSON 3.73.1 373010 2020-06-11
diffoscope JSON 3.66.5 366050 2021-03-15
diffoscope JSON 3.66.5 366050 2020-01-25
diffoscope JSON 3.66.2 366020 2021-03-15
diffoscope JSON 3.66.2 366020 2019-12-20
diffoscope JSON 3.44.2 344020 2021-03-15
diffoscope JSON 3.44.2 344020 2019-01-16
diffoscope JSON 3.42.2 342020 2021-03-15
diffoscope JSON 3.42.2 342020 2018-12-06
de.uwepost.android.deltacam DeltaCamera diffoscope JSON 1.1 11 2021-03-15
diffoscope JSON 1.1 11 2019-01-16
de.viatorus.neo2externalkeyboard Neo2 External Keyboard diffoscope JSON 1.1.0 1 2021-04-04
de.wger.flutter wger Workout Manager diffoscope JSON 1.8.3 80 2025-06-23
de.wuapps.moredays moreDays diffoscope JSON 1.0.24 24 2024-12-07
diffoscope JSON 1.0.23 23 2024-06-14
diffoscope JSON 1.0.22 22 2024-02-25
diffoscope JSON 1.0.21 21 2024-02-03
diffoscope JSON 1.0.20 20 2024-01-19
diffoscope JSON 1.0.18 18 2023-09-11
diffoscope JSON 1.0.17 17 2023-05-20
diffoscope JSON 1.0.16 16 2023-03-25
diffoscope JSON 1.0.15 15 2023-02-15
diffoscope JSON 1.0.12 12 2022-11-06
diffoscope JSON 1.0.11 11 2022-08-10
de.yazo_games.mensaguthaben Mensa-Guthaben diffoscope JSON 1.2.1 15 2021-03-15
deckers.thibault.aves.libre Aves Libre diffoscope JSON 1.13.4 15504 2025-07-20
diffoscope JSON 1.13.4 15502 2025-07-19
diffoscope JSON 1.13.4 15501 2025-07-18
diffoscope JSON 1.13.3 15404 2025-07-17
diffoscope JSON 1.13.3 15402 2025-07-17
diffoscope JSON 1.13.3 15401 2025-07-15
diffoscope JSON 1.13.2 15304 2025-06-11
diffoscope JSON 1.13.1 15202 2025-05-20
diffoscope JSON 1.12.10 15001 2025-04-24
diffoscope JSON 1.12.3 14301 2025-02-21
dev.linwood.butterfly.nightly Linwood Butterfly Nightly diffoscope JSON 2.4.0-beta.1 141 2025-07-29
diffoscope JSON 2.4.0-beta.0 139 2025-07-18
diffoscope JSON 2.3.0-rc.0 133 2025-04-19
diffoscope JSON 2.3.0-beta.2 130 2025-03-10
diffoscope JSON 2.3.0-beta.1 129 2025-02-01
diffoscope JSON 2.2.4 128 2025-01-20
diffoscope JSON 2.3.0-beta.0 127 2025-01-18
diffoscope JSON 2.2.3 126 2025-01-21
diffoscope JSON 2.2.2-rc.1 121 2024-12-11
dev.obfusk.sokobang Sokoban(g) diffoscope JSON 0.2.2 1000202001 2021-04-05
dev.patrickgold.florisboard FlorisBoard diffoscope JSON 0.4.6 104 2025-03-10
diffoscope JSON 0.4.5 103 2025-01-20
diffoscope JSON 0.4.2 100 2024-12-18
diffoscope JSON 0.4.2 100 2024-12-17
diffoscope JSON 0.4.1 99 2024-12-14
diffoscope JSON 0.3.7 26 2021-03-15
diffoscope JSON 0.3.7 26 2021-03-07
dmusiolik.pijaret Pijaret diffoscope JSON 1.7 9 2021-03-15
dnsfilter.android personalDNSfilter diffoscope JSON 1.50.58.0 1505800 2025-07-17
diffoscope JSON 1.50.57.1 1505701 2025-05-15
diffoscope JSON 1.50.40.0 1504000 2021-03-15
diffoscope JSON 1.50.40.0 1504000 2020-06-11
diffoscope JSON 1.50.39.1 1503901 2021-03-15
diffoscope JSON 1.50.39.1 1503901 2020-05-22
diffoscope JSON 1.50.36.0 1503600 2021-03-15
diffoscope JSON 1.50.36.0 1503600 2020-01-24
diffoscope JSON 1.50.34.4 1503404 2021-03-15
diffoscope JSON 1.50.34.4 1503404 2019-12-20
diffoscope JSON 1.50.33.5 1503305 2021-03-15
diffoscope JSON 1.50.33.5 1503305 2019-09-12
diffoscope JSON 1.50.32.1 1503201 2021-03-15
diffoscope JSON 1.50.32.1 1503201 2019-07-11
diffoscope JSON 1.50.30.1 1503010 2021-03-15
diffoscope JSON 1.50.30.1 1503010 2019-04-06
diffoscope JSON 1.50.28 1502800 2021-03-15
diffoscope JSON 1.50.28 1502800 2019-01-16
douzifly.list Clear List diffoscope JSON 1.5.6 21 2021-03-15
diffoscope JSON 1.5.6 21 2018-10-17
dudeofx.eval Expression Evaluator diffoscope JSON 1.1 101 2021-03-15
diffoscope JSON 1.1 101 2018-10-17
dummydomain.yetanothercallblocker Yet Another Call Blocker diffoscope JSON 0.5.17 5170 2022-08-16
diffoscope JSON 0.5.14 5140 2021-05-30
diffoscope JSON 0.5.13 5130 2021-03-15
diffoscope JSON 0.5.13 5130 2021-03-06
diffoscope JSON 0.4.4 4040 2021-03-15
diffoscope JSON 0.4.4 4040 2020-06-10
diffoscope JSON 0.4.1 4010 2021-03-15
diffoscope JSON 0.4.1 4010 2020-05-21
edu.berkeley.boinc BOINC diffoscope JSON 8.2.4 80204 2025-07-17
diffoscope JSON 8.0.0 80000 2024-06-14
diffoscope JSON 7.24.1 72401 2023-11-27
diffoscope JSON 7.22.2 72202 2023-05-23
diffoscope JSON 7.22.1 72201 2023-05-13
diffoscope JSON 7.22.0 72200 2023-04-11
diffoscope JSON 7.16.16 71616 2021-03-15
diffoscope JSON 7.16.16 71616 2021-03-06
es.ideotec.wdnotes WD Notes diffoscope JSON 1.0.2 3 2022-12-17
eth.matteljay.mastermindy MasterMindy diffoscope JSON 20190923 20190923 2021-03-15
diffoscope JSON 20190923 20190923 2019-12-20
eu.flatworld.android.slider SliderSynth diffoscope JSON 2.3.1 20301 2021-03-15
eu.halaser.beamctrl BeamControl for Smart Interface diffoscope JSON 1.03 103 2021-03-15
diffoscope JSON 1.03 103 2018-12-07
eu.neilalexander.yggdrasil Yggdrasil diffoscope JSON 0.1-020 20 2025-02-03
diffoscope JSON 0.1-016 16 2023-12-05
diffoscope JSON 0.1-015 15 2023-11-26
diffoscope JSON 0.1-013 13 2022-12-31
diffoscope JSON 0.1-012 12 2022-12-18
eu.polarclock Polar Clock diffoscope JSON 1.3 5 2021-03-15
eu.pretix.pretixscan.droid pretixSCAN diffoscope JSON 2.10.2 98 2025-03-03
diffoscope JSON 2.10.1 97 2024-12-17
diffoscope JSON 2.10.0 96 2024-12-14
diffoscope JSON 2.8.2 94 2024-05-11
diffoscope JSON 2.7.1 91 2024-03-06
diffoscope JSON 2.7.0 90 2024-02-19
diffoscope JSON 1.8.0 31 2021-03-15
diffoscope JSON 1.8.0 31 2021-03-14
diffoscope JSON 1.4.0 22 2021-03-15
diffoscope JSON 1.4.0 22 2020-05-21
diffoscope JSON 1.2.1 16 2021-03-15
diffoscope JSON 1.2.1 16 2019-12-20
eu.quelltext.gita Bhagavad Gita diffoscope JSON 1.5 6 2021-03-15
diffoscope JSON 1.5 6 2019-04-06
eu.tilk.cdlcplayer CDLC Player diffoscope JSON 0.0.6 6 2022-08-11
eu.uwot.fabio.altcoinprices Altcoin Prices diffoscope JSON 1.7.4 81 2021-03-15
diffoscope JSON 1.7.4 81 2019-12-22
diffoscope JSON 1.6.19 75 2021-03-15
diffoscope JSON 1.6.19 75 2019-01-16
diffoscope JSON 1.6.18 74 2021-03-15
diffoscope JSON 1.6.18 74 2018-12-06
diffoscope JSON 0.3d 3 2021-03-15
diffoscope JSON 0.3d 3 2018-10-17
eu.veldsoft.colors.overflow Colors Overflow diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
eu.veldsoft.svarka.odds.calculator Svarka Odds Calculator diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
felixwiemuth.lincal LinCal diffoscope JSON 1.3.0 12 2021-03-15
diffoscope JSON 1.3.0 12 2018-10-17
diffoscope JSON 1.0.0 9 2021-03-15
fi.harism.wallpaper.flier Flier diffoscope JSON 3.2 18 2021-03-15
diffoscope JSON 3.2 18 2018-10-17
fi.harism.wallpaper.flowers Peppy Flowers diffoscope JSON 3.2 10 2021-03-15
diffoscope JSON 3.2 10 2018-10-17
fil.libre.repwifiapp RepWifi diffoscope JSON 0.5 3 2021-03-15
flunzmas.seasoncalendar Seasonal Foods Calendar diffoscope JSON 1.5.0 45 2022-11-09
diffoscope JSON 1.4.7 42 2021-03-15
diffoscope JSON 1.4.7 42 2021-03-08
fly.speedmeter.grub Speedmeter diffoscope JSON 2.3.1 24 2021-03-15
fm.helio Helio diffoscope JSON 3.16 316 2025-05-30
diffoscope JSON 3.15 315 2025-04-30
diffoscope JSON 3.14 314 2024-12-14
diffoscope JSON 3.12 312 2024-02-20
fr.ac_versailles.dane.xiaexpress Xia Express diffoscope JSON 1.1 15 2021-03-15
diffoscope JSON 1.1 15 2018-12-06
fr.bellev.stdatmosphere Std Atmosphere diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
fr.byped.bwarearea BwareArea diffoscope JSON 0.6.6 4 2021-03-15
diffoscope JSON 0.6.6 4 2019-07-11
fr.fdesousa.bikesharinghub BikeSharingHub diffoscope JSON 2.1.4 33 2025-07-26
diffoscope JSON 2.1.3 32 2024-12-07
diffoscope JSON 2.1.1 30 2024-02-22
diffoscope JSON 2.1.0 28 2022-12-16
diffoscope JSON 2.0.6 27 2022-08-10
fr.gaulupeau.apps.InThePoche wallabag diffoscope JSON 2.5.1 231 2023-11-24
diffoscope JSON 2.4.3 229 2022-01-11
diffoscope JSON 2.4.2 228 2021-03-15
diffoscope JSON 2.4.2 228 2021-03-09
diffoscope JSON 2.4.0-beta.1 220 2021-03-15
diffoscope JSON 2.4.0-beta.1 220 2020-05-21
diffoscope JSON 2.3.0 219 2021-03-15
diffoscope JSON 2.3.0 219 2019-12-21
diffoscope JSON 2.0.0 104 2021-03-15
diffoscope JSON 2.0.0 104 2018-10-17
diffoscope JSON 1.12.2 32 2021-03-15
diffoscope JSON 1.12.1 31 2021-03-15
fr.hnit.riverferry RiverFerry diffoscope JSON 0.3 3 2021-03-15
diffoscope JSON 0.3 3 2018-10-17
fr.jnda.android.ipcalc IPCalc Android diffoscope JSON 2.1 1577458331 2021-03-15
diffoscope JSON 2.1 1577458331 2020-01-25
diffoscope JSON 2.0 1561300851 2021-03-15
diffoscope JSON 2.0 1561300851 2019-12-22
fr.miximum.napply Napply diffoscope JSON 1.2 2 2021-03-15
diffoscope JSON 1.2 2 2018-10-17
fr.mobdev.blooddonation Don du Sang diffoscope JSON 3.5 14 2021-03-15
diffoscope JSON 3.5 14 2019-12-22
diffoscope JSON 3.4 12 2021-03-15
diffoscope JSON 3.4 12 2018-10-17
diffoscope JSON 3.3 11 2021-03-15
diffoscope JSON 3.3 11 2018-10-17
fr.mobdev.goblim Goblim diffoscope JSON 2.8 11 2021-03-15
diffoscope JSON 2.8 11 2018-10-17
diffoscope JSON 2.7 10 2021-03-15
diffoscope JSON 2.7 10 2018-10-17
diffoscope JSON 2.4 7 2021-03-15
fr.odrevet.bide_et_musique Bide et Musique diffoscope JSON 4.1.1 57 2025-07-26
diffoscope JSON 4.0.1 51 2022-08-15
fr.rhaz.ipfs.sweet Sweet IPFS diffoscope JSON 0.2 20 2021-03-15
diffoscope JSON 0.2 20 2019-01-16
fr.s13d.photobackup PhotoBackup diffoscope JSON 0.11.0 33 2021-03-15
diffoscope JSON 0.11.0 33 2018-10-17
fr.s3i.pointeuse Oburo.O diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
fr.ubordeaux.math.paridroid PariDroid diffoscope JSON 2.15.3.2.3 28 2023-07-11
diffoscope JSON 2.13.4.2.2 25 2022-08-14
diffoscope JSON 2.13.1.1.9 21 2021-03-15
diffoscope JSON 2.13.1.1.9 21 2021-03-11
diffoscope JSON 2.11.3.1.7 19 2021-03-15
diffoscope JSON 2.11.3.1.7 19 2020-05-21
diffoscope JSON 2.11.2.1.6 18 2021-03-15
diffoscope JSON 2.11.2.1.6 18 2019-09-12
diffoscope JSON 2.11.1.1.6 16 2021-03-15
diffoscope JSON 2.11.1.1.6 16 2019-04-06
diffoscope JSON 2.9.1.1.4 13 2021-03-15
diffoscope JSON 2.9.1.1.4 13 2018-10-17
fr.unix_experience.owncloud_sms Nextcloud SMS diffoscope JSON 2.0.5 69 2021-03-15
diffoscope JSON 2.0.5 69 2019-01-16
diffoscope JSON 0.24.1 45 2021-03-15
fr.witchdoctors.c4ffein.oosfirmwareextractor OOS Firmware Extractor diffoscope JSON 0.3.0 6 2021-03-15
diffoscope JSON 0.3.0 6 2019-04-06
diffoscope JSON 0.2.2 4 2021-03-15
diffoscope JSON 0.2.2 4 2019-01-16
fr.xtof54.dragonGoApp DragonGoApp diffoscope JSON 1.10 10 2021-03-15
diffoscope JSON 1.10 10 2018-10-17
fr.ybo.transportsbordeaux Transports Bordeaux diffoscope JSON 3.2.5 325 2021-03-15
fr.ybo.transportsrennes Transports Rennes diffoscope JSON 4.1.3 413 2021-03-15
free.rm.skytube.legacy.oss SkyTube Legacy diffoscope JSON 2.995 55 2025-02-22
diffoscope JSON 2.994 54 2025-02-21
diffoscope JSON 2.993 53 2025-02-01
diffoscope JSON 2.991 51 2024-12-10
diffoscope JSON 2.988 48 2024-06-15
diffoscope JSON 2.987 47 2023-10-01
diffoscope JSON 2.986 46 2023-05-01
diffoscope JSON 2.984 44 2022-11-08
free.rm.skytube.oss SkyTube diffoscope JSON 2.995 55 2025-02-22
diffoscope JSON 2.994 54 2025-02-21
diffoscope JSON 2.993 53 2025-02-01
diffoscope JSON 2.991 51 2024-12-10
diffoscope JSON 2.988 48 2024-06-15
diffoscope JSON 2.987 47 2023-10-01
diffoscope JSON 2.986 46 2023-04-28
diffoscope JSON 2.984 44 2022-11-08
diffoscope JSON 2.978 38 2021-04-03
diffoscope JSON 2.977 37 2021-03-15
diffoscope JSON 2.977 37 2021-03-08
diffoscope JSON 2.972 32 2021-03-15
diffoscope JSON 2.972 32 2020-05-21
diffoscope JSON 2.969 29 2021-03-15
diffoscope JSON 2.969 29 2020-01-24
diffoscope JSON 2.968 28 2021-03-15
diffoscope JSON 2.968 28 2019-12-20
diffoscope JSON 2.93 17 2021-03-15
diffoscope JSON 2.93 17 2019-01-16
diffoscope JSON 2.60 9 2021-03-15
diffoscope JSON 2.3 5 2021-03-15
ga.testapp.testapp TestApp diffoscope JSON 4.2.6 66 2021-03-15
diffoscope JSON 4.2.6 66 2021-03-13
diffoscope JSON 4.0.2 57 2021-03-15
diffoscope JSON 4.0.2 57 2020-06-11
diffoscope JSON 3.0.0 30 2021-03-15
diffoscope JSON 3.0.0 30 2020-01-25
giraffine.dimmer Dimmer diffoscope JSON 3.3.1 37 2021-03-15
diffoscope JSON 3.3.1 37 2018-10-17
github.rikodot.kardi_notes kardi notes | privacy matters diffoscope JSON 2.1.3 28 2025-03-03
github.umer0586.sensorserver Sensor Server diffoscope JSON 6.4.0 34 2024-12-11
diffoscope JSON 6.3.2 33 2024-12-14
github.yaa110.memento Memento diffoscope JSON 1.1.0 2 2021-03-15
diffoscope JSON 1.1.0 2 2018-10-17
github.yaa110.piclice Piclice diffoscope JSON 0.2 2 2021-03-15
diffoscope JSON 0.2 2 2018-10-17
godau.fynn.dsbdirect ESBDirect diffoscope JSON 3.4 41 2022-08-11
diffoscope JSON 3.1 36 2021-03-15
diffoscope JSON 3.1 36 2020-05-21
godau.fynn.usagedirect.system Museum of a broken API diffoscope JSON 0.7 8 2021-06-01
diffoscope JSON 0.6 7 2021-03-15
diffoscope JSON 0.6 7 2021-03-14
gr.ratmole.android.Mach3Pendant Mach3Pendant diffoscope JSON 1.05 14 2021-03-15
groomiac.voicemailplayer Voice Mail Player diffoscope JSON 1.3 13 2022-12-25
hashengineering.darkcoin.wallet Dash Wallet diffoscope JSON 10.0.2 100021 2024-02-20
diffoscope JSON 9.0.6 90061 2024-06-15
hsware.HSTempo HSTempo diffoscope JSON 1.2.1.1 17 2021-03-15
diffoscope JSON 1.2.1.1 17 2018-10-17
hu.vsza.adsdroid ADSdroid diffoscope JSON 1.6 8 2021-03-15
diffoscope JSON 1.6 8 2018-10-17
im.status.ethereum Status: Ethereum Crypto Wallet diffoscope JSON 1.20.3 2023022315 2024-02-29
im.vector.app Element - Secure Messenger diffoscope JSON 1.6.12 40106124 2024-02-24
diffoscope JSON 1.6.10 40106104 2024-02-12
diffoscope JSON 1.1.0 40101000 2021-03-15
diffoscope JSON 1.1.0 40101000 2021-03-06
in.ac.iitb.cse.cartsbusboarding Carts Bus Boarding diffoscope JSON 0.1.5 15 2021-03-15
diffoscope JSON 0.1.5 15 2018-10-17
in.eike.better_stundenplan Better Stundenplan diffoscope JSON 1.2.1 2 2025-05-12
diffoscope JSON 1.1.1 1 2025-05-04
in.umairkhan.remotedroid Remote Droid diffoscope JSON 0.1 1 2021-03-15
diffoscope JSON 0.1 1 2018-10-17
inc.flide.vi8 8Vim Keyboard diffoscope JSON 0.16.3 160300 2023-11-24
diffoscope JSON 0.16.2 160200 2023-10-23
diffoscope JSON 0.16.1 160100 2023-10-19
info.aario.killcamera Kill Camera diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
info.aario.mywifipasswords My Wifi Passwords diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2019-01-16
info.guardianproject.gilga Gilga diffoscope JSON 0.0.12 12 2021-03-15
diffoscope JSON 0.0.12 12 2018-10-17
info.meoblast001.thugaim Thugaim diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.0 1 2021-03-15
info.metadude.android.bitsundbaeume.schedule Bits & Bäume 2022 Schedule diffoscope JSON 1.55.1-Bits-und-Baeume-Edition 90 2022-11-07
info.metadude.android.cccamp.schedule Camp 2023 diffoscope JSON 1.61.0-CCCamp-Edition 96 2023-09-02
info.metadude.android.clt.schedule CLT 2025 Schedule diffoscope JSON 1.69.0-CLT-Edition 107 2025-02-21
diffoscope JSON 1.58.0-CLT-Edition 93 2023-02-22
info.metadude.android.congress.schedule 38C3 Schedule diffoscope JSON 1.70.0 108 2025-04-10
diffoscope JSON 1.69.0 107 2025-02-02
diffoscope JSON 1.68.0 106 2024-12-05
diffoscope JSON 1.64.0 101 2024-06-15
diffoscope JSON 1.63.2 100 2024-05-13
diffoscope JSON 1.63.1 99 2024-01-29
diffoscope JSON 1.63.0 98 2024-01-23
diffoscope JSON 1.62.0 97 2023-12-23
diffoscope JSON 1.55.0 89 2022-11-08
diffoscope JSON 1.54.0 88 2022-08-14
diffoscope JSON 1.51.0 83 2021-05-30
diffoscope JSON 1.50.0 82 2021-03-15
diffoscope JSON 1.47.0 76 2021-03-15
diffoscope JSON 1.47.0 76 2021-03-10
diffoscope JSON 1.43.1 70 2021-03-15
diffoscope JSON 1.43.1 70 2020-06-11
info.metadude.android.datenspuren.schedule Datenspuren 2024 diffoscope JSON 1.66.0-Datenspuren-Edition 104 2024-12-14
diffoscope JSON 1.61.0-Datenspuren-Edition 96 2023-09-17
diffoscope JSON 1.55.0-Datenspuren-Edition 89 2022-11-08
diffoscope JSON 1.46.0-Datenspuren-Edition 75 2021-03-15
diffoscope JSON 1.46.0-Datenspuren-Edition 75 2021-03-11
diffoscope JSON 1.40.0-Datenspuren-Edition 61 2021-03-15
diffoscope JSON 1.40.0-Datenspuren-Edition 61 2019-12-21
info.metadude.android.divoc.schedule DiVOC Schedule diffoscope JSON 1.50.0-DiVOC-Edition 82 2021-04-03
diffoscope JSON 1.45.3-DiVOC-Edition 76 2021-03-15
diffoscope JSON 1.45.3-DiVOC-Edition 76 2021-03-11
info.metadude.android.fosdem.schedule FOSDEM 2025 Schedule diffoscope JSON 1.69.1-FOSDEM-Edition 108 2025-02-05
diffoscope JSON 1.69.0-FOSDEM-Edition 107 2025-02-02
diffoscope JSON 1.63.2-FOSDEM-Edition 100 2024-05-13
diffoscope JSON 1.63.1-FOSDEM-Edition 99 2024-01-29
diffoscope JSON 1.63.0-FOSDEM-Edition 98 2024-01-28
diffoscope JSON 1.57.0-FOSDEM-Edition 92 2023-02-17
diffoscope JSON 1.50.0-FOSDEM-Edition 82 2021-04-04
diffoscope JSON 1.49.1-FOSDEM-Edition 81 2021-03-15
diffoscope JSON 1.49.1-FOSDEM-Edition 81 2021-03-07
info.metadude.android.foss4g.schedule FOSS4G Europe 2025 diffoscope JSON 1.58.2-FOSS4G-Edition 95 2023-09-03
info.metadude.android.fossgis.schedule FOSSGIS 2025 Schedule diffoscope JSON 1.69.2-FOSSGIS-Edition 109 2025-04-30
diffoscope JSON 1.69.1-FOSSGIS-Edition 108 2025-02-25
diffoscope JSON 1.63.2-FOSSGIS-Edition 100 2024-05-13
info.metadude.android.gpn.schedule GPN 2025 Schedule diffoscope JSON 1.64.0-GPN-Edition 101 2024-06-15
diffoscope JSON 1.59.0-GPN-Edition 94 2023-09-04
diffoscope JSON 1.54.0-GPN-Edition 88 2022-11-09
info.metadude.android.libreoffice.schedule LibreOffice 2024 Schedule diffoscope JSON 1.66.2-LibreOffice-Edition 106 2024-12-09
diffoscope JSON 1.55.0-LibreOffice-Edition 89 2022-11-08
info.metadude.android.mrmcd.schedule MRMCD 2024 Schedule diffoscope JSON 1.66.1-MRMCD-Edition 105 2024-12-10
diffoscope JSON 1.61.0-MRMCD-Edition 96 2023-09-07
info.metadude.android.rc3.schedule JEV 2022 Schedule diffoscope JSON 1.56.1-JEV-Edition 91 2022-12-25
diffoscope JSON 1.56.0-JEV-Edition 90 2022-12-20
diffoscope JSON 1.54.0-rC3-Edition 88 2022-08-14
diffoscope JSON 1.49.1-rC3-Edition 81 2021-03-15
diffoscope JSON 1.49.1-rC3-Edition 81 2021-03-08
info.schnatterer.nusic nusic diffoscope JSON 3.3.3 24 2022-08-15
diffoscope JSON 3.3.1 22 2021-03-15
diffoscope JSON 3.3.1 22 2019-09-11
diffoscope JSON 3.2.0 20 2021-03-15
diffoscope JSON 3.2.0 20 2018-10-17
info.staticfree.SuperGenPass SuperGenPass diffoscope JSON 3.0.0 22 2021-03-15
diffoscope JSON 3.0.0 22 2018-10-17
info.zamojski.soft.towercollector Tower Collector diffoscope JSON 2.16.0 2160018 2025-03-27
diffoscope JSON 2.15.6 2150617 2025-01-21
diffoscope JSON 2.15.5 2150516 2025-04-22
diffoscope JSON 2.15.4 2150415 2024-12-10
diffoscope JSON 2.15.3 2150314 2024-12-05
diffoscope JSON 2.15.1 2150112 2024-12-02
diffoscope JSON 2.14.6 2140610 2024-06-15
diffoscope JSON 2.14.5 2140505 2024-03-04
diffoscope JSON 2.14.4 2140403 2023-10-10
diffoscope JSON 2.14.3 2140302 2023-07-06
diffoscope JSON 2.14.2 2140201 2023-04-10
diffoscope JSON 2.14.1 2140100 2022-08-11
diffoscope JSON 2.8.3 2080385 2021-05-29
diffoscope JSON 2.7.4 2070476 2021-03-15
diffoscope JSON 2.7.4 2070476 2021-03-07
diffoscope JSON 2.3.0 2030065 2021-03-15
diffoscope JSON 2.3.0 2030065 2020-06-11
diffoscope JSON 2.0.1 2000134 2021-03-15
diffoscope JSON 2.0.1 2000134 2019-01-16
diffoscope JSON 2.0.0 2000031 2021-03-15
diffoscope JSON 2.0.0 2000031 2018-12-06
io.anuke.mindustry Mindustry diffoscope JSON 8-fdroid-149 1074 2025-05-09
diffoscope JSON 8-fdroid-148 1073 2025-05-01
diffoscope JSON 8-fdroid-147.1 1072 2025-05-08
io.davidar.fabularium Fabularium diffoscope JSON 1.5.1 27 2025-02-26
io.ente.auth ente - encrypted photo storage diffoscope JSON 2.0.56 256 2024-05-12
diffoscope JSON 2.0.55 255 2024-04-12
io.ente.photos.fdroid Ente Photos - Encrypted photo storage diffoscope JSON 0.8.75 595 2024-04-10
diffoscope JSON 0.8.74 594 2024-04-06
diffoscope JSON 0.8.62 582 2024-02-24
io.github.benoitduffez.cupsprint CUPS Printing diffoscope JSON 1.5.0 1050099 2021-03-15
diffoscope JSON 1.5.0 1050099 2020-05-22
diffoscope JSON 1.4.0 9 2021-03-15
diffoscope JSON 1.4.0 9 2018-10-17
diffoscope JSON 1.3.1 8 2021-03-15
diffoscope JSON 1.3.1 8 2018-10-17
io.github.divverent.aaaaxy AAAAXY diffoscope JSON 1.6.252+20250707.3870.8aede291 106302524 2025-07-19
diffoscope JSON 1.6.252+20250707.3870.8aede291 106302523 2025-07-18
diffoscope JSON 1.6.252+20250707.3870.8aede291 106302522 2025-07-17
diffoscope JSON 1.6.252+20250707.3870.8aede291 106302521 2025-07-16
diffoscope JSON 1.6.241+20250602.3859.cce2e21a 106302414 2025-06-12
diffoscope JSON 1.6.241+20250602.3859.cce2e21a 106302413 2025-06-11
diffoscope JSON 1.6.241+20250602.3859.cce2e21a 106302412 2025-06-10
diffoscope JSON 1.6.241+20250602.3859.cce2e21a 106302411 2025-06-09
diffoscope JSON 1.6.194+20250423.3812.ce4a067b 106301944 2025-05-07
diffoscope JSON 1.6.194+20250423.3812.ce4a067b 106301943 2025-05-06
diffoscope JSON 1.6.194+20250423.3812.ce4a067b 106301942 2025-05-05
diffoscope JSON 1.6.194+20250423.3812.ce4a067b 106301941 2025-05-04
diffoscope JSON 1.6.176+20250407.3794.55a60435 106301764 2025-04-20
diffoscope JSON 1.6.176+20250407.3794.55a60435 106301763 2025-04-19
diffoscope JSON 1.6.176+20250407.3794.55a60435 106301762 2025-04-18
diffoscope JSON 1.6.176+20250407.3794.55a60435 106301761 2025-04-17
diffoscope JSON 1.6.64+20250324.3682.13887e2e 106300644 2025-04-16
diffoscope JSON 1.6.64+20250324.3682.13887e2e 106300643 2025-04-15
diffoscope JSON 1.6.64+20250324.3682.13887e2e 106300642 2025-04-11
diffoscope JSON 1.6.64+20250324.3682.13887e2e 106300641 2025-04-11
diffoscope JSON 1.6.0+20250223.3618.0de18b79 106300004 2025-03-13
diffoscope JSON 1.6.0+20250223.3618.0de18b79 106300003 2025-03-12
diffoscope JSON 1.6.0+20250223.3618.0de18b79 106300002 2025-03-11
diffoscope JSON 1.6.0+20250223.3618.0de18b79 106300001 2025-03-10
diffoscope JSON 1.5.256+20250113.3575.02bcdf3a 105302564 2025-03-09
diffoscope JSON 1.5.256+20250113.3575.02bcdf3a 105302563 2025-03-06
diffoscope JSON 1.5.256+20250113.3575.02bcdf3a 105302562 2025-03-05
diffoscope JSON 1.5.256+20250113.3575.02bcdf3a 105302561 2025-03-04
diffoscope JSON 1.5.250+20250106.3569.dc794da9 105302504 2025-03-03
diffoscope JSON 1.5.250+20250106.3569.dc794da9 105302503 2025-03-02
diffoscope JSON 1.5.250+20250106.3569.dc794da9 105302502 2025-03-01
diffoscope JSON 1.5.250+20250106.3569.dc794da9 105302501 2025-02-27
diffoscope JSON 1.5.54+20240407.3373.3f58f518 105300544 2024-04-12
diffoscope JSON 1.5.54+20240407.3373.3f58f518 105300541 2024-06-15
diffoscope JSON 1.5.42+20240304.3361.65bd9a62 105300424 2024-03-09
diffoscope JSON 1.5.23+20240226.3342.5382b42a 105300234 2024-02-28
diffoscope JSON 1.5.6+20240219.3325.eaf4bbab 105300064 2024-02-25
diffoscope JSON 1.3.372+20230312.2837.59bd43df 103030372 2023-03-15
diffoscope JSON 1.3.367+20230306.2832.1bc596e5 103030367 2023-03-09
diffoscope JSON 1.3.359+20230227.2824.871612fc 103030359 2023-03-03
diffoscope JSON 1.3.343+20230222.2808.ed2d3490 103030343 2023-02-25
diffoscope JSON 1.3.334+20230220.2799.eb8ee229 103030334 2023-02-22
diffoscope JSON 1.3.303+20230212.2768.bfe2720d 103030303 2023-02-15
diffoscope JSON 1.3.43+20221219.2508.f8e76f4d 103030043 2022-12-21
diffoscope JSON 1.2.399+20221201.2413.88973067 102031399 2022-12-14
diffoscope JSON 1.2.372+20221029.2386.37cd743f 102031372 2022-11-05
io.github.dlbeswick.kreuungching Ching Machine diffoscope JSON 1.19 11900 2024-06-15
io.github.engsergiu.react React diffoscope JSON 1.4.0 4 2021-03-15
io.github.fvasco.pinpoi PinPoi diffoscope JSON 1.11.3 96 2024-12-09
diffoscope JSON 1.11.1 94 2024-12-07
diffoscope JSON 1.10.7 91 2024-12-07
diffoscope JSON 1.7.6 78 2022-03-12
diffoscope JSON 1.7.5 77 2022-01-08
diffoscope JSON 1.5.5 66 2021-03-15
diffoscope JSON 1.5.5 66 2018-12-06
diffoscope JSON 1.4.20 52 2021-03-15
diffoscope JSON 1.4.20 52 2018-10-17
diffoscope JSON 1.4.19 51 2021-03-15
diffoscope JSON 1.4.19 51 2018-10-17
diffoscope JSON 1.4.16 48 2021-03-15
diffoscope JSON 1.4.16 48 2018-10-17
diffoscope JSON 1.4.10 42 2021-03-15
diffoscope JSON 1.4.10 42 2018-10-17
diffoscope JSON 1.4.7 39 2021-03-15
io.github.gsantner.memetastic MemeTastic diffoscope JSON 1.7.3 73 2023-09-19
diffoscope JSON 1.7.1 72 2023-04-02
diffoscope JSON 1.7.0 70 2022-01-11
diffoscope JSON 1.6.7 68 2021-03-15
diffoscope JSON 1.6.7 68 2021-03-09
diffoscope JSON 1.6.5 66 2021-03-15
diffoscope JSON 1.6.5 66 2020-06-11
diffoscope JSON 1.6.4 65 2021-03-15
diffoscope JSON 1.6.4 65 2020-01-25
diffoscope JSON 1.6.3 63 2021-03-15
diffoscope JSON 1.6.3 63 2019-12-21
diffoscope JSON 1.5.1 51 2021-03-15
diffoscope JSON 1.5.1 51 2019-01-16
diffoscope JSON 1.5.0 50 2021-03-15
diffoscope JSON 1.5.0 50 2018-12-06
diffoscope JSON 1.2.7 37 2021-03-15
diffoscope JSON 1.2.7 37 2018-10-17
diffoscope JSON 0.9.0 14 2021-03-15
diffoscope JSON 0.9.0 14 2018-10-17
io.github.lufte.lona Lona diffoscope JSON 1.0.2 10002 2021-05-31
io.github.mimoguz.tripeaksneue TriPeaks NEUE diffoscope JSON 0.9.2 72 2025-05-20
diffoscope JSON 0.9.2 71 2025-05-19
diffoscope JSON 0.9.1 63 2025-05-14
diffoscope JSON 0.9.1 62 2025-05-13
diffoscope JSON 0.9.1 61 2025-05-12
diffoscope JSON 0.9.0 53 2025-04-26
diffoscope JSON 0.9.0 52 2025-04-25
diffoscope JSON 0.9.0 51 2025-04-24
diffoscope JSON 0.8.4 43 2025-04-18
diffoscope JSON 0.8.4 42 2025-04-17
diffoscope JSON 0.8.4 41 2025-04-16
diffoscope JSON 0.8.2 23 2025-04-15
diffoscope JSON 0.8.2 22 2025-04-11
diffoscope JSON 0.8.2 21 2025-04-11
io.github.mthli.Ninja Ninja diffoscope JSON 1.3.4 26 2021-03-15
diffoscope JSON 1.3.4 26 2018-10-17
io.github.powerinside.scrollsocket ScrollSocket diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
io.github.saeeddev94.xray Xray diffoscope JSON 10.8.4 784 2025-06-20
diffoscope JSON 10.8.4 783 2025-06-19
diffoscope JSON 10.8.4 782 2025-06-18
diffoscope JSON 10.8.4 781 2025-06-17
diffoscope JSON 10.8.2 764 2025-06-16
diffoscope JSON 10.8.2 763 2025-06-15
diffoscope JSON 10.8.2 762 2025-06-14
diffoscope JSON 10.8.2 761 2025-06-13
diffoscope JSON 10.8.0 744 2025-06-12
diffoscope JSON 10.8.0 743 2025-06-11
diffoscope JSON 10.8.0 742 2025-06-10
diffoscope JSON 10.8.0 741 2025-06-09
diffoscope JSON 8.3.0 531 2025-01-21
diffoscope JSON 8.1.0 511 2024-12-11
io.github.snd_r.komelia Komelia diffoscope JSON 0.15.0 8 2025-04-11
diffoscope JSON 0.14.1 7 2025-02-21
diffoscope JSON 0.13.0 5 2025-01-20
diffoscope JSON 0.11.1 1 2024-12-14
diffoscope JSON 0.11.1 1 2024-12-13
io.githubfede0d.planetrider Planet Rider diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
io.gitlab.derjosef.jigsaw Jigsaw diffoscope JSON 1.1.1 10112 2025-04-20
diffoscope JSON 1.1.1 10111 2025-04-19
diffoscope JSON 1.1.0 10102 2025-04-11
diffoscope JSON 1.1.0 10101 2025-04-11
io.gresse.hugo.anecdote Anecdote diffoscope JSON 1.1.5 23 2021-03-15
diffoscope JSON 1.1.4 22 2021-03-15
diffoscope JSON 1.1.4 22 2018-10-17
io.itch.pirate_solitaire Pirate Solitaire diffoscope JSON 1.3 3 2024-04-17
diffoscope JSON 1.0 1 2023-11-26
io.librehealth.toolkit.cost_of_care LibreHealth Cost Of Care Explorer diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2021-03-09
io.mkg20001.arubanetworkslogin Aruba Networks Login diffoscope JSON 0.5 5000 2021-03-15
diffoscope JSON 0.5 5000 2018-12-06
io.muetsch.anchrandroid Anchr for Android diffoscope JSON 1.2.5 33 2022-08-15
diffoscope JSON 1.2.1 29 2021-06-01
io.neurolab NeuroLab diffoscope JSON 1.0.0 1 2021-03-15
diffoscope JSON 1.0.0 1 2020-05-21
io.oopquizz.oopquiz Java OOP Quiz diffoscope JSON 1.0.0 1 2025-06-09
io.open_biking Open Biking diffoscope JSON 1.1.0 2 2024-05-16
io.oversec.one Oversec diffoscope JSON 1.5.15 1005015 2021-03-15
diffoscope JSON 1.5.15 1005015 2019-12-22
diffoscope JSON 1.5.7 1005007 2021-03-15
diffoscope JSON 1.5.7 1005007 2019-01-16
is.binary.alcoholnow Er ríkið opið? diffoscope JSON 1.2.0 6 2022-01-11
is.xyz.mpv mpv-android diffoscope JSON 2023-11-30-release 33 2024-02-20
it.danieleverducci.ojo Ojo RTSP IP Camera viewer diffoscope JSON 0.1.4 9 2024-05-11
diffoscope JSON 0.1.0 4 2022-03-11
diffoscope JSON 0.0.3 3 2022-01-10
it.ecosw.dudo Dudo diffoscope JSON 0.7.1 20 2021-03-15
diffoscope JSON 0.7.1 20 2018-10-17
it.rgp.nyagua.pafcalc PAFCalc diffoscope JSON 1.0 4 2021-03-15
diffoscope JSON 1.0 4 2018-10-17
it.zitzusoft.lyrics_2 Lyrics 2 diffoscope JSON 1.0.3 27 2024-04-14
diffoscope JSON 1.0.1 25 2024-06-15
italian.said.fran.theitaliansaid The Italian Said diffoscope JSON 2.0 2 2021-03-15
diffoscope JSON 2.0 2 2018-10-17
itkach.aard2 Aard 2 diffoscope JSON 0.56 56 2024-01-05
jp.nonbili.noutube NouTube diffoscope JSON 0.1.16 17 2025-07-26
diffoscope JSON 0.1.15 16 2025-07-22
diffoscope JSON 0.1.13 14 2025-07-17
diffoscope JSON 0.1.12 13 2025-07-16
jp.takke.cpustats CPU Stats diffoscope JSON 2.2.0 24 2023-11-26
diffoscope JSON 2.1.0 17 2021-03-15
diffoscope JSON 2.1.0 17 2019-12-23
jp.yhonda MaximaOnAndroid diffoscope JSON 2.8 21 2021-03-15
diffoscope JSON 2.8 21 2018-10-17
jpf.android.magiadni MagiaDNI diffoscope JSON 2.0 10 2021-03-15
diffoscope JSON 1.8 9 2021-03-15
jsettlers.main.android JSettlers diffoscope JSON v0.6.0.6-alpha 23002418 2023-04-29
julianwi.javainstaller Java installer diffoscope JSON 0.5.1 7 2021-03-15
diffoscope JSON 0.5.1 7 2018-10-17
kaljurand_at_gmail_dot_com.diktofon Diktofon diffoscope JSON 0.9.83 983 2021-03-15
diffoscope JSON 0.9.83 983 2018-10-17
koeln.mop.elpeefpe Elpe Efpe diffoscope JSON 1.1 2 2021-03-15
kr.softgear.multiping MultiPing diffoscope JSON 0.11 11 2021-03-15
diffoscope JSON 0.11 11 2018-10-17
krasilnikov.alexey.cryptopass CryptoPass diffoscope JSON 1.2 4 2021-03-15
la.daube.photochiotte PhotoChiotte diffoscope JSON 1.52 53 2024-03-11
diffoscope JSON 1.51 52 2024-03-02
diffoscope JSON 1.50 51 2024-02-20
diffoscope JSON 1.49 50 2024-01-22
diffoscope JSON 1.48 49 2024-01-15
diffoscope JSON 1.47 48 2024-01-06
diffoscope JSON 1.46 47 2023-11-25
diffoscope JSON 1.35 36 2023-03-31
diffoscope JSON 1.33 34 2023-02-14
diffoscope JSON 1.31 32 2022-12-16
diffoscope JSON 1.30 31 2022-11-05
diffoscope JSON 1.29 30 2022-08-10
lanchon.sigspoof.checker Signature Spoofing Checker diffoscope JSON 1.0 1 2021-03-15
libretasks.app LibreTasks diffoscope JSON 0.5.0 21 2021-03-15
diffoscope JSON 0.5.0 21 2018-10-17
link.standen.michael.fatesheets Fate Sheets diffoscope JSON 1.2 8 2021-03-15
diffoscope JSON 1.2 8 2018-10-17
diffoscope JSON 1.0 6 2021-03-15
diffoscope JSON 1.0 6 2018-10-17
ltd.evilcorp.atox aTox diffoscope JSON 0.7.2 12 2022-08-15
lu.fisch.canze CanZE diffoscope JSON 1.62 94 2022-01-11
luke.launcher LukeLauncher diffoscope JSON 2.0.3 20003 2022-01-08
diffoscope JSON 2.0.1 20001 2021-04-03
diffoscope JSON 2.0.0 20000 2021-03-15
diffoscope JSON 2.0.0 20000 2021-03-08
m.co.rh.id.a_personal_stuff Personal Stuff diffoscope JSON 1.3.0 14 2023-09-03
diffoscope JSON 1.2.0 13 2024-06-15
makeinfo.com.getid Get ID diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
mattecarra.accapp Advanced Charging Controller (ACCA) diffoscope JSON 1.0.29 33 2021-03-15
diffoscope JSON 1.0.29 33 2021-03-10
diffoscope JSON 1.0.24 28 2021-03-15
diffoscope JSON 1.0.24 28 2020-06-11
max.music_cyclon music-cyclon diffoscope JSON 0.3.1 4 2021-03-15
diffoscope JSON 0.3.1 4 2018-12-07
mbmb5.lumixextendedcontrolapp Eylca diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
me.anon.grow GrowTracker diffoscope JSON 2.6.4 2631 2022-08-12
diffoscope JSON 2.6.1 1370 2021-03-15
diffoscope JSON 2.6.1 1370 2020-01-25
diffoscope JSON 2.5.2 23 2021-03-15
diffoscope JSON 2.5.2 23 2019-12-22
me.anuraag.grader Gradr diffoscope JSON 1.1 3 2021-03-15
diffoscope JSON 1.1 3 2018-10-17
me.bgregos.brighttask Foreground diffoscope JSON 1.6.1 20 2023-09-02
me.echeung.moemoekyun.fdroid LISTEN.moe diffoscope JSON 6.0.2 206 2024-03-09
diffoscope JSON 5.4.3 106 2022-11-08
me.knighthat.kreate Kreate diffoscope JSON 1.5.1-fdroid 103 2025-06-26
diffoscope JSON 1.5.0-fdroid 102 2025-06-20
diffoscope JSON 1.4.2-fdroid 101 2025-06-13
diffoscope JSON 1.4.1-fdroid 100 2025-06-10
diffoscope JSON 1.1.5-fdroid 91 2025-04-19
diffoscope JSON 1.1.3-fdroid 89 2025-04-15
diffoscope JSON 1.1.2-fdroid 88 2025-04-11
diffoscope JSON 1.1.0-fdroid 86 2025-04-11
me.mgerdes.open_golf Open Golf diffoscope JSON 1.0 1 2022-08-13
me.tagavari.airmessage AirMessage diffoscope JSON 3.5.2-fdroid 139 2022-12-16
me.timschneeberger.rootlessjamesdsp RootlessJamesDSP diffoscope JSON 1.6.14 51 2025-05-08
diffoscope JSON 1.6.13 50 2025-01-18
diffoscope JSON 1.6.12 49 2025-03-06
diffoscope JSON 1.6.11 48 2025-03-12
diffoscope JSON 1.6.9 46 2024-12-17
diffoscope JSON 1.6.8 45 2024-02-21
diffoscope JSON 1.6.5 42 2024-06-15
menion.android.whereyougo WhereYouGo diffoscope JSON 2023.02.22 20230222 2023-02-25
miccah.mpvremote mpv remote diffoscope JSON 0.0.5 2 2022-11-08
miru.miaomint Miru diffoscope JSON 1.8.1 39 2024-02-19
mixedbit.speechtrainer Speech Trainer diffoscope JSON 1.04 5 2021-03-15
diffoscope JSON 1.04 5 2018-10-17
mkg20001.net.samremote Sam Remote diffoscope JSON 1.1 10100 2021-03-15
diffoscope JSON 1.1 10100 2018-12-06
mobi.boilr.boilr Boilr diffoscope JSON 0.7.0 9 2021-03-15
mobi.omegacentauri.SendReduced Send Reduced diffoscope JSON 0.28 2800 2022-11-08
diffoscope JSON 0.13 1300 2021-03-15
diffoscope JSON 0.13 1300 2018-10-17
moe.martini.midictrl MIDICtrl diffoscope JSON 0.1.3 4 2021-03-15
diffoscope JSON 0.1.3 4 2021-03-07
name.boyle.chris.sgtpuzzles Simon Tatham's Puzzles diffoscope JSON 2024-03-29-2245-fd304c53-fdroid 146 2024-06-15
diffoscope JSON 2019-03-26-0844-68363231 120 2021-03-15
diffoscope JSON 2019-03-26-0844-68363231 120 2019-12-22
diffoscope JSON 2018-10-27-1350-f281644b 117 2021-03-15
diffoscope JSON 2018-10-27-1350-f281644b 117 2019-01-16
diffoscope JSON 2016-12-25-0849-0b34887 115 2021-03-15
diffoscope JSON 2016-12-25-0849-0b34887 115 2018-10-17
name.bresciani.marco.tkcompanionapp TKCompanionApp diffoscope JSON 6.8.1 681 2024-12-13
diffoscope JSON 6.8.0 680 2024-06-15
name.seguri.android.getforegroundactivity Get Foreground Activity diffoscope JSON 1.0.2 3 2021-03-15
nds.fyll.puzzle_grid Puzzle Grid diffoscope JSON 2.1.2 14 2021-03-15
diffoscope JSON 2.1.2 14 2021-03-05
negativedensity.techahashi Techahashi diffoscope JSON 7.0.1 70001 2021-03-15
diffoscope JSON 7.0.1 70001 2019-12-22
net.alegen.android.netclip Netclip diffoscope JSON 1.3 4 2021-03-15
net.alexbarry.calc_android AlexCalc diffoscope JSON 1.0.7 11 2025-06-20
diffoscope JSON 1.0.6 10 2025-02-01
net.asceai.meritous Meritous diffoscope JSON 0.0.4 4 2021-03-15
diffoscope JSON 0.0.4 4 2019-01-16
net.bitconomy.ckpoolwatcher CKPool Watcher diffoscope JSON 0.1.0 1 2021-03-15
diffoscope JSON 0.1.0 1 2018-10-17
net.bitplane.android.microphone Microphone diffoscope JSON 0.7 7 2021-03-15
diffoscope JSON 0.7 7 2018-10-17
net.bluetoothviewer Bluetooth Viewer (LITE) diffoscope JSON 1.1.2 8 2021-03-15
diffoscope JSON 1.1.2 8 2018-10-17
net.casimirlab.frigoligo Frigoligo diffoscope JSON 2.2.0 38 2025-01-20
net.chilon.matt.teacup TeaCup diffoscope JSON 1.7 8 2021-03-15
net.cozic.joplin Joplin diffoscope JSON 3.0.3 2097742 2024-05-10
diffoscope JSON 3.0.1 2097740 2024-03-24
net.ddns.mlsoftlaberge.trycorder Trycorder diffoscope JSON 5.1.8 518 2021-03-15
diffoscope JSON 5.1.3 513 2021-03-15
net.drawpile Drawpile diffoscope JSON 2.2.2-fix.1 2020299014 2025-04-18
diffoscope JSON 2.2.2-fix.1 2020299013 2025-04-16
diffoscope JSON 2.2.2-fix.1 2020299012 2025-04-11
diffoscope JSON 2.2.2-fix.1 2020299011 2025-04-11
diffoscope JSON 2.2.2-beta.5 2020205004 2025-02-25
diffoscope JSON 2.2.2-beta.5 2020205003 2025-02-23
diffoscope JSON 2.2.2-beta.5 2020205002 2025-02-22
diffoscope JSON 2.2.2-beta.5 2020205001 2025-02-21
diffoscope JSON 2.2.2-beta.4 2020204004 2024-12-10
diffoscope JSON 2.2.2-beta.4 2020204003 2024-12-09
diffoscope JSON 2.2.2-beta.4 2020204002 2024-12-07
diffoscope JSON 2.2.2-beta.4 2020204001 2024-12-07
net.e1547 e1547 - e621 browser diffoscope JSON 20.2.0 98 2025-06-25
net.fercanet.LNM Learn Music Notes diffoscope JSON 1.4 5 2021-03-15
diffoscope JSON 1.4 5 2018-10-17
net.gcompris.full GCompris diffoscope JSON 4.0 40000 2024-02-26
diffoscope JSON 3.2 30200 2023-04-04
diffoscope JSON 3.1 30100 2023-02-17
diffoscope JSON 2.4 20400 2022-08-14
net.georgewhiteside.android.abstractart Abstract Art diffoscope JSON 1.0.0 15 2021-03-15
diffoscope JSON 1.0.0 15 2018-10-17
net.glsk.wpgen WPGen diffoscope JSON 1.3.3 133 2021-03-15
diffoscope JSON 1.3.3 133 2018-10-17
net.gsantner.dandelior dandelior* diffoscope JSON 1.2.3 36 2021-03-15
diffoscope JSON 1.2.3 36 2018-12-06
net.gsantner.markor Markor diffoscope JSON 2.14.1 158 2025-03-15
diffoscope JSON 2.14.0 157 2025-01-18
diffoscope JSON 2.13.1 156 2024-12-11
diffoscope JSON 2.12.0 149 2024-06-15
diffoscope JSON 2.11.1 148 2023-10-16
diffoscope JSON 2.10.9 146 2023-06-11
diffoscope JSON 2.10.7 143 2023-01-11
diffoscope JSON 2.10.6 142 2022-11-05
diffoscope JSON 2.10.1 134 2022-08-11
diffoscope JSON 2.8.4 128 2022-01-09
diffoscope JSON 2.6.0 122 2021-03-15
diffoscope JSON 2.6.0 122 2021-03-05
diffoscope JSON 2.2.10 113 2021-03-15
diffoscope JSON 2.2.10 113 2020-05-21
diffoscope JSON 2.2.5 107 2021-03-15
diffoscope JSON 2.2.5 107 2020-01-24
diffoscope JSON 2.2.3 104 2021-03-15
diffoscope JSON 2.2.3 104 2019-12-21
diffoscope JSON 1.6.0 45 2021-03-15
diffoscope JSON 1.6.0 45 2019-01-16
diffoscope JSON 1.4.0 40 2021-03-15
diffoscope JSON 1.4.0 40 2018-12-06
net.i2p.android.router I2P diffoscope JSON 2.7.1 4745289 2025-02-27
diffoscope JSON 2.5.0 4745281 2024-04-12
diffoscope JSON 2.4.0 4745280 2024-02-20
diffoscope JSON 0.9.29 4745236 2021-03-15
diffoscope JSON 0.9.29 4745236 2018-10-17
diffoscope JSON 0.9.28 4745235 2021-03-15
diffoscope JSON 0.9.28 4745235 2018-10-17
net.ibbaa.keepitup Keep it up diffoscope JSON 1.7.0 12 2025-05-04
diffoscope JSON 1.6.2 11 2025-01-20
diffoscope JSON 1.6.1 10 2025-01-21
diffoscope JSON 1.6.0 9 2025-01-18
diffoscope JSON 1.5.0 8 2024-12-10
diffoscope JSON 1.3.0 5 2024-06-15
diffoscope JSON 1.2.0 4 2023-10-12
diffoscope JSON 1.1.0 3 2022-08-11
net.inbox.pager Inbox Pager diffoscope JSON 6.4 20 2021-03-15
diffoscope JSON 6.4 20 2021-03-08
diffoscope JSON 5.0 15 2021-03-15
diffoscope JSON 4.0 9 2021-03-15
diffoscope JSON 4.0 9 2018-12-06
diffoscope JSON 2.1 5 2021-03-15
diffoscope JSON 2.1 5 2018-10-17
net.ivpn.client IVPN - Secure VPN for Privacy diffoscope JSON 2.10.12 137 2025-02-26
diffoscope JSON 2.10.11 136 2025-02-01
diffoscope JSON 2.10.7 130 2024-02-14
diffoscope JSON 2.10.6 129 2023-12-23
diffoscope JSON 2.10.5 128 2023-12-16
diffoscope JSON 2.10.4 127 2023-11-24
diffoscope JSON 2.8.6 117 2023-04-20
diffoscope JSON 2.8.5 116 2023-03-18
diffoscope JSON 2.8.3 114 2022-08-12
diffoscope JSON 2.3.1 94 2021-03-15
diffoscope JSON 2.2.0 92 2021-03-15
diffoscope JSON 2.2.0 92 2021-03-07
net.kervala.comicsreader Comics Reader diffoscope JSON 2.2.171 28 2021-03-15
diffoscope JSON 2.2.171 28 2018-10-17
net.ktnx.mobileledger MoLe diffoscope JSON 0.21.7 56 2024-06-15
diffoscope JSON 0.11.0 30 2021-03-15
diffoscope JSON 0.11.0 30 2019-12-20
net.loeuillet.wifi_eap_sim_conf WIFI_EAP_SIM_Conf diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
net.majorkernelpanic.spydroid Spydroid diffoscope JSON 10 1000 2021-03-15
diffoscope JSON 10 1000 2018-10-17
net.mcarolan.whenzebus When Ze Bus diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
net.minetest.minetest Luanti diffoscope JSON 5.12.0 5120000 2025-06-13
diffoscope JSON 5.11.0 5110000 2025-02-23
diffoscope JSON 5.10.0 5100000 2024-12-11
diffoscope JSON 5.9.1 5090100 2024-12-14
diffoscope JSON 5.8.1 48 2024-05-15
diffoscope JSON 5.7.0 44 2023-04-13
diffoscope JSON 5.2.0.26 26 2021-03-15
diffoscope JSON 5.1.0.25 25 2021-03-15
diffoscope JSON 5.1.0.25 25 2020-01-25
diffoscope JSON 5.0.1.24 24 2021-03-15
diffoscope JSON 5.0.1.24 24 2019-12-22
diffoscope JSON 0.4.17.21 21 2021-03-15
diffoscope JSON 0.4.17.21 21 2019-01-16
diffoscope JSON 0.4.16.17 17 2021-03-15
diffoscope JSON 0.4.16.17 17 2018-10-17
net.nullsum.freedoom Freedoom diffoscope JSON 0.4.3 20 2024-05-15
net.opendasharchive.openarchive.release OpenArchive diffoscope JSON 0.0.17-alpha-1 17 2021-03-15
diffoscope JSON 0.0.17-alpha-1 17 2018-10-17
net.osmand.plus OsmAnd~ diffoscope JSON 3.7.3 373 2021-03-15
diffoscope JSON 3.7.3 373 2020-06-10
diffoscope JSON 3.5.5 355 2021-03-15
diffoscope JSON 3.5.5 355 2019-12-20
diffoscope JSON 3.2.7 327 2021-03-15
diffoscope JSON 3.2.7 327 2018-12-06
net.pejici.summation Summation diffoscope JSON 0.1.2 3 2021-03-15
net.phunehehe.foocam fooCam beta diffoscope JSON v1.2 4 2021-03-15
diffoscope JSON v1.2 4 2018-10-17
net.programmierecke.radiodroid2 RadioDroid diffoscope JSON 0.86 96 2023-10-06
diffoscope JSON 0.84 94 2021-03-15
diffoscope JSON 0.84 94 2021-03-09
diffoscope JSON 0.83 93 2021-03-15
diffoscope JSON 0.83 93 2020-05-21
diffoscope JSON 0.79 89 2021-03-15
diffoscope JSON 0.79 89 2019-12-22
diffoscope JSON 0.69 79 2021-03-15
diffoscope JSON 0.69 79 2019-01-16
diffoscope JSON 0.37 47 2021-03-15
diffoscope JSON 0.31 41 2021-03-15
net.redsolver.noteless Noteless diffoscope JSON 1.3.1 131 2021-03-15
diffoscope JSON 1.3.1 131 2021-03-09
net.reichholf.dreamdroid dreamDroid diffoscope JSON 1.15.460 460 2024-01-06
diffoscope JSON 1.12.456 456 2023-02-16
diffoscope JSON 1.5.439 439 2021-03-15
diffoscope JSON 1.5.439 439 2020-05-22
diffoscope JSON 1.3.430 430 2021-03-15
diffoscope JSON 1.3.430 430 2019-01-16
net.retiolus.exhale ExHale diffoscope JSON 0.3.1 15003 2025-03-02
diffoscope JSON 0.3.1 15002 2025-03-01
diffoscope JSON 0.3.1 15001 2025-02-27
net.retiolus.natinfo NATINFo+ diffoscope JSON 0.7.2 32003 2025-07-25
diffoscope JSON 0.7.2 32002 2025-07-24
diffoscope JSON 0.7.2 32001 2025-07-23
diffoscope JSON 0.7.1 31003 2025-07-22
diffoscope JSON 0.7.1 31002 2025-07-21
diffoscope JSON 0.7.1 31001 2025-07-20
diffoscope JSON 0.7.0 30003 2025-07-19
diffoscope JSON 0.7.0 30002 2025-07-18
diffoscope JSON 0.7.0 30001 2025-07-17
diffoscope JSON 0.6.5 28002 2025-07-16
diffoscope JSON 0.6.5 28001 2025-07-08
diffoscope JSON 0.6.4 27003 2025-06-25
diffoscope JSON 0.6.4 27002 2025-06-24
diffoscope JSON 0.6.4 27001 2025-06-23
diffoscope JSON 0.6.2 25003 2025-06-20
diffoscope JSON 0.6.2 25002 2025-06-19
diffoscope JSON 0.6.2 25001 2025-06-18
diffoscope JSON 0.6.1 24003 2025-06-17
diffoscope JSON 0.6.1 24002 2025-06-16
diffoscope JSON 0.6.1 24001 2025-06-15
diffoscope JSON 0.5.1 22003 2025-06-14
diffoscope JSON 0.5.1 22002 2025-06-13
diffoscope JSON 0.5.1 22001 2025-06-12
diffoscope JSON 0.4.0 20003 2025-06-11
diffoscope JSON 0.4.0 20002 2025-06-10
diffoscope JSON 0.4.0 20001 2025-06-09
diffoscope JSON 0.3.4 19003 2025-06-03
diffoscope JSON 0.3.4 19002 2025-06-02
diffoscope JSON 0.3.4 19001 2025-05-27
diffoscope JSON 0.3.2 17003 2025-05-25
diffoscope JSON 0.3.2 17002 2025-05-24
diffoscope JSON 0.3.2 17001 2025-05-23
net.schueller.instarepost Easy Repost and Downloader for Instagram diffoscope JSON 2.0.5 205 2021-03-15
diffoscope JSON 2.0.5 205 2021-03-10
net.schueller.peertube Thorium a PeerTube client diffoscope JSON 1.12.2 1080 2022-08-14
diffoscope JSON 1.4.0 1060 2021-03-15
diffoscope JSON 1.4.0 1060 2021-03-06
diffoscope JSON 1.0.30 1030 2021-03-15
diffoscope JSON 1.0.30 1030 2019-12-22
diffoscope JSON 1.0.24 1024 2021-03-15
diffoscope JSON 1.0.24 1024 2019-01-16
diffoscope JSON 1.0.5 105 2021-03-15
diffoscope JSON 1.0.5 105 2018-12-06
net.sf.andbatdog.batterydog Battery Dog diffoscope JSON 0.1.1 11 2021-03-15
diffoscope JSON 0.1.1 11 2018-10-17
net.sf.ethersynth Etheric Synthesizer diffoscope JSON 0.1.0 100 2021-03-15
net.solutinno.websearch WebSearch diffoscope JSON 1.0.4 7 2021-03-15
diffoscope JSON 1.0.4 7 2018-10-17
net.sourceforge.dibdib.android.dib2qm Dib2Qm diffoscope JSON 0.24.28 2428 2025-03-25
diffoscope JSON 0.24.20 2420 2023-07-06
net.sourceforge.kid3 Kid3 diffoscope JSON 3.9.5 29 2024-02-26
diffoscope JSON 3.9.3 27 2023-02-20
diffoscope JSON 3.9.2 26 2022-08-15
diffoscope JSON 3.8.6 22 2021-05-31
diffoscope JSON 3.8.5 21 2021-03-15
diffoscope JSON 3.8.5 21 2021-03-14
diffoscope JSON 3.8.3 19 2021-03-15
diffoscope JSON 3.8.3 19 2020-06-11
diffoscope JSON 3.8.1 17 2021-03-15
diffoscope JSON 3.8.1 17 2020-01-25
diffoscope JSON 3.8.0 16 2021-03-15
diffoscope JSON 3.8.0 16 2019-12-22
diffoscope JSON 3.7.1 15 2021-03-15
diffoscope JSON 3.7.1 15 2019-07-10
net.sourceforge.opencamera Open Camera diffoscope JSON 1.54.1 92 2025-04-24
diffoscope JSON 1.50.1 85 2022-08-12
diffoscope JSON 1.48.3 80 2021-03-15
diffoscope JSON 1.48.3 80 2021-03-09
diffoscope JSON 1.48.1 77 2021-03-15
diffoscope JSON 1.48.1 77 2020-05-21
diffoscope JSON 1.47.3 74 2021-03-15
diffoscope JSON 1.47.3 74 2019-12-21
diffoscope JSON 1.41.1 53 2021-03-15
diffoscope JSON 1.41.1 53 2018-10-17
diffoscope JSON 1.40 51 2021-03-15
diffoscope JSON 1.40 51 2018-10-17
diffoscope JSON 1.37 46 2021-03-15
diffoscope JSON 1.37 46 2018-10-17
net.sourceforge.wifiremoteplay Wifi Remote Play diffoscope JSON 1.13 9 2021-03-15
diffoscope JSON 1.13 9 2018-10-17
net.sourceforge.x11basic X11-Basic diffoscope JSON 1.27-63 163 2021-03-15
diffoscope JSON 1.27-63 163 2021-03-08
diffoscope JSON 1.27-59 159 2021-03-15
diffoscope JSON 1.27-59 159 2020-05-21
diffoscope JSON 1.25-50-sf 150 2021-03-15
diffoscope JSON 1.25-50-sf 150 2019-07-11
net.syntaxblitz.plucklock PluckLock diffoscope JSON 1.0.5 6 2021-03-15
diffoscope JSON 1.0.5 6 2018-10-17
net.tjado.passwdsafe Authorizer diffoscope JSON 0.5.0 500 2023-12-03
diffoscope JSON 0.4.0 400 2021-03-15
diffoscope JSON 0.4.0 400 2019-12-22
net.turtton.ytalarm YtAlarm diffoscope JSON 0.1.0 104 2022-12-16
net.usikkert.kouchat.android KouChat diffoscope JSON 1.1.0 15 2021-03-15
net.wigle.wigleandroid WiGLE WiFi Wardriving FOSS diffoscope JSON 2.80 280 2024-02-21
diffoscope JSON 2.10 210 2021-03-15
diffoscope JSON 2.10 210 2018-10-17
net.xisberto.timerpx Timer +X diffoscope JSON 1.4.2 10 2024-12-14
diffoscope JSON 1.4.1 9 2023-10-05
diffoscope JSON 1.3.0 7 2022-12-30
diffoscope JSON 1.2.2 6 2022-08-12
net.xzos.upgradeall UpgradeAll diffoscope JSON 0.13-beta.4 104 2023-09-04
net.ygingras.minutemaze Minute Maze diffoscope JSON 0.2.1 201 2025-02-26
net.yxejamir.misbotheringsms Misbothering SMS Receiver diffoscope JSON 0.1.0 1000000 2021-03-15
diffoscope JSON 0.1.0 1000000 2018-10-17
network.loki.messenger.fdroid Session F-Droid diffoscope JSON 1.18.1 3695 2024-03-10
diffoscope JSON 1.17.5 3605 2024-02-20
diffoscope JSON 1.13.7 2885 2022-08-10
news.androidtv.launchonboot Launch on Boot diffoscope JSON 1.1.3 12 2021-03-15
diffoscope JSON 1.1.3 12 2020-06-11
nightlock.peppercarrot Pepper&Carrot Reader diffoscope JSON 1.4 12 2023-12-17
diffoscope JSON 1.0.1 7 2021-03-15
diffoscope JSON 1.0.1 7 2018-12-07
nl.asymmetrics.droidshows DroidShows diffoscope JSON 7.11.8 71108 2024-03-18
diffoscope JSON 7.11.7 71107 2024-03-11
diffoscope JSON 7.7.2 772 2021-03-15
diffoscope JSON 7.7.0 770 2021-03-15
diffoscope JSON 7.6.2 762 2021-03-15
diffoscope JSON 7.4.1 741 2021-03-15
diffoscope JSON 7.4.0 740 2021-03-15
diffoscope JSON 7.3.5 735 2021-03-15
diffoscope JSON 7.3.4 734 2021-03-15
diffoscope JSON 7.3.3 733 2021-03-15
nl.eduvpn.app eduVPN diffoscope JSON 3.4.0 32 2025-06-13
diffoscope JSON 3.3.4 31 2024-12-07
diffoscope JSON 3.2.2 26 2024-02-12
nl.implode.regenalarm RainTime diffoscope JSON 4.3.0 40300 2021-03-15
diffoscope JSON 4.3.0 40300 2018-10-17
diffoscope JSON 4.1.1 40101 2021-03-15
nodom.darkfm.inventoryguimobile InventoryGUI Mobile diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
nodomain.freeyourgadget.tpmsmonitor TpmsMonitor diffoscope JSON 0.0.1 alpha 1 2021-03-15
diffoscope JSON 0.0.1 alpha 1 2019-12-23
nodomain.hoopdraw Hoop Draw diffoscope JSON 1.0.0 1 2025-07-22
ohi.andre.consolelauncher T-UI diffoscope JSON v6.15 205 2021-03-15
diffoscope JSON v6.15 205 2019-12-23
diffoscope JSON 6.3j 136 2021-03-15
diffoscope JSON 4.5.b1 75 2021-03-15
diffoscope JSON 4.5.b1 75 2018-10-17
ohm.quickdice Quick Dice Roller diffoscope JSON 2.1.4 48 2021-03-15
ooo.akito.webmon Webmon diffoscope JSON 2.9.0 14 2022-12-22
openfoodfacts.github.scrachx.openfood Open Food Facts diffoscope JSON 4.14.0 1280 2024-03-10
diffoscope JSON 4.12.0 1251 2024-02-21
diffoscope JSON 3.6.8 433 2021-03-15
diffoscope JSON 3.2.8 328 2021-03-15
diffoscope JSON 3.2.8 328 2020-05-22
diffoscope JSON 3.2.5 325 2021-03-15
diffoscope JSON 3.2.5 325 2019-12-21
diffoscope JSON 2.9.8 298 2021-03-15
diffoscope JSON 2.9.8 298 2019-01-16
diffoscope JSON 0.7.4 37 2021-03-15
diffoscope JSON 0.7.4 37 2018-10-17
org.afhdownloader AFH Downloader diffoscope JSON 0.4.5 10 2021-03-15
diffoscope JSON 0.4.4 9 2021-03-15
org.akvo.rsr.up Akvo RSR Up diffoscope JSON 1.2.4 15 2021-03-15
diffoscope JSON 1.2.4 15 2018-10-17
org.amoradi.syncopoli Syncopoli diffoscope JSON v0.7.2 26 2022-12-16
diffoscope JSON v0.6 24 2021-03-15
diffoscope JSON v0.6 24 2020-05-22
diffoscope JSON v0.5.3 23 2021-03-15
diffoscope JSON v0.5.3 23 2019-01-16
diffoscope JSON v0.4.2 10 2021-03-15
diffoscope JSON v0.4.2 10 2018-10-17
org.androidfromfrankfurt.archnews ArchNews diffoscope JSON 2.0 4 2021-03-15
diffoscope JSON 2.0 4 2018-10-17
org.androidsoft.app.permission Permission Friendly Apps diffoscope JSON 2.1.0 18 2021-03-15
diffoscope JSON 2.1.0 18 2018-10-17
org.androidsoft.coloring Coloring for Kids diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2018-10-17
org.appsroid.fxpro Effects Pro diffoscope JSON 1.1.0 1 2021-03-15
diffoscope JSON 1.1.0 1 2018-10-17
org.asdtm.fas Inventum diffoscope JSON 0.3 3 2021-03-15
org.aykit.MyOwnNotes MyOwnNotes diffoscope JSON 2.0 11 2021-03-15
org.b3log.siyuan SiYuan diffoscope JSON 3.0.3 222 2024-03-13
diffoscope JSON 3.0.2 221 2024-03-09
diffoscope JSON 2.12.8 218 2024-02-18
diffoscope JSON 2.12.7 217 2024-02-09
org.balau.fakedawn Fake Dawn diffoscope JSON 1.3 4 2021-03-15
diffoscope JSON 1.3 4 2018-10-17
org.bienvenidoainternet.app Bienvenido a Internet diffoscope JSON 1.9.1 13 2021-03-15
diffoscope JSON 1.9.1 13 2019-12-22
diffoscope JSON 1.9 12 2021-03-15
org.billthefarmer.accordion Accordion diffoscope JSON 1.22 122 2024-01-29
diffoscope JSON 1.21 121 2022-11-07
diffoscope JSON 1.19 119 2022-08-15
diffoscope JSON 1.17 117 2021-03-15
diffoscope JSON 1.17 117 2021-03-08
diffoscope JSON 1.16 116 2021-03-15
diffoscope JSON 1.16 116 2020-01-25
diffoscope JSON 1.15 115 2021-03-15
diffoscope JSON 1.15 115 2019-12-22
diffoscope JSON 1.14 114 2021-03-15
diffoscope JSON 1.14 114 2019-01-16
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.13 113 2018-12-07
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.10 110 2018-10-17
org.billthefarmer.buses Buses diffoscope JSON 1.07 107 2023-12-27
diffoscope JSON 1.06 106 2023-11-25
diffoscope JSON 1.05 105 2023-08-31
diffoscope JSON 1.03 103 2023-05-02
diffoscope JSON 1.02 102 2022-12-17
org.billthefarmer.crossword Crossword diffoscope JSON 1.24 124 2023-11-24
diffoscope JSON 1.23 123 2024-07-01
diffoscope JSON 1.22 122 2023-10-12
diffoscope JSON 1.21 121 2022-08-13
diffoscope JSON 1.17 117 2021-03-15
diffoscope JSON 1.17 117 2021-03-06
diffoscope JSON 1.15 115 2021-03-15
diffoscope JSON 1.15 115 2020-05-21
diffoscope JSON 1.14 114 2021-03-15
diffoscope JSON 1.14 114 2020-01-25
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.13 113 2019-12-20
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.10 110 2019-01-16
diffoscope JSON 1.05 105 2021-03-15
diffoscope JSON 1.02 102 2021-03-15
org.billthefarmer.currency Currency diffoscope JSON 1.56 156 2023-11-26
diffoscope JSON 1.55 155 2023-10-04
diffoscope JSON 1.54 154 2023-09-10
diffoscope JSON 1.53 153 2023-08-31
diffoscope JSON 1.51 151 2023-07-07
diffoscope JSON 1.50 150 2023-06-21
diffoscope JSON 1.49 149 2023-06-18
diffoscope JSON 1.47 147 2022-11-06
diffoscope JSON 1.36 136 2021-05-30
diffoscope JSON 1.35 135 2021-03-15
diffoscope JSON 1.35 135 2021-03-07
diffoscope JSON 1.33 133 2021-03-15
diffoscope JSON 1.33 133 2020-05-21
diffoscope JSON 1.31 131 2021-03-15
diffoscope JSON 1.31 131 2020-01-24
diffoscope JSON 1.24 124 2021-03-15
diffoscope JSON 1.24 124 2019-01-16
diffoscope JSON 1.22 122 2021-03-15
diffoscope JSON 1.22 122 2018-12-06
diffoscope JSON 1.12 112 2021-03-15
diffoscope JSON 1.11 111 2021-03-15
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.08 108 2021-03-15
diffoscope JSON 1.07 107 2021-03-15
org.billthefarmer.diary Diary diffoscope JSON 1.105 1105 2024-03-10
diffoscope JSON 1.104 1104 2023-12-19
diffoscope JSON 1.103 1103 2023-11-25
diffoscope JSON 1.102 1102 2023-09-07
diffoscope JSON 1.101 1101 2023-09-01
diffoscope JSON 1.98 198 2023-06-13
diffoscope JSON 1.97 197 2023-02-16
diffoscope JSON 1.96 196 2022-12-16
diffoscope JSON 1.88 188 2022-08-11
diffoscope JSON 1.78 178 2021-05-30
diffoscope JSON 1.76 176 2021-03-15
diffoscope JSON 1.76 176 2021-03-07
diffoscope JSON 1.67 167 2021-03-15
diffoscope JSON 1.67 167 2020-06-11
diffoscope JSON 1.66 166 2021-03-15
diffoscope JSON 1.66 166 2020-05-21
diffoscope JSON 1.61 161 2021-03-15
diffoscope JSON 1.61 161 2020-01-24
diffoscope JSON 1.60 160 2021-03-15
diffoscope JSON 1.60 160 2019-12-20
diffoscope JSON 1.39 139 2021-03-15
diffoscope JSON 1.39 139 2019-01-16
diffoscope JSON 1.33 133 2021-03-15
diffoscope JSON 1.33 133 2018-12-06
diffoscope JSON 1.22 122 2021-03-15
diffoscope JSON 1.22 122 2018-10-17
diffoscope JSON 1.20 120 2021-03-15
diffoscope JSON 1.20 120 2018-10-17
diffoscope JSON 1.19 119 2021-03-15
diffoscope JSON 1.17 117 2021-03-15
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.02 102 2021-03-15
org.billthefarmer.editor Editor diffoscope JSON 1.96 196 2024-04-08
diffoscope JSON 1.95 195 2024-02-24
diffoscope JSON 1.94 194 2024-07-01
diffoscope JSON 1.93 193 2024-02-18
diffoscope JSON 1.92 192 2023-12-27
diffoscope JSON 1.91 191 2023-12-17
diffoscope JSON 1.90 190 2023-11-25
diffoscope JSON 1.89 189 2023-10-12
diffoscope JSON 1.88 188 2023-10-08
diffoscope JSON 1.87 187 2023-06-08
diffoscope JSON 1.86 186 2023-05-23
diffoscope JSON 1.84 184 2023-03-15
diffoscope JSON 1.83 183 2023-03-04
diffoscope JSON 1.82 182 2023-03-01
diffoscope JSON 1.81 181 2023-02-16
diffoscope JSON 1.79 179 2023-01-05
diffoscope JSON 1.78 178 2022-12-15
diffoscope JSON 1.75 175 2022-11-06
diffoscope JSON 1.55 155 2021-05-29
diffoscope JSON 1.53 153 2021-04-02
diffoscope JSON 1.52 152 2021-03-15
diffoscope JSON 1.52 152 2021-03-08
diffoscope JSON 1.48 148 2021-03-15
diffoscope JSON 1.48 148 2020-05-21
diffoscope JSON 1.45 145 2021-03-15
diffoscope JSON 1.45 145 2019-12-20
diffoscope JSON 1.28 128 2021-03-15
diffoscope JSON 1.28 128 2019-01-16
diffoscope JSON 1.26 126 2021-03-15
diffoscope JSON 1.26 126 2018-12-06
diffoscope JSON 1.14 114 2021-03-15
diffoscope JSON 1.14 114 2018-10-17
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.10 110 2018-10-17
diffoscope JSON 1.09 109 2021-03-15
diffoscope JSON 1.09 109 2018-10-17
diffoscope JSON 1.08 108 2021-03-15
org.billthefarmer.gridle Gridle diffoscope JSON 1.18 118 2023-12-27
diffoscope JSON 1.17 117 2023-12-16
diffoscope JSON 1.16 116 2023-11-26
diffoscope JSON 1.15 115 2023-11-02
diffoscope JSON 1.14 114 2023-10-10
diffoscope JSON 1.13 113 2023-07-09
diffoscope JSON 1.12 112 2023-06-22
diffoscope JSON 1.11 111 2023-06-13
diffoscope JSON 1.09 109 2023-02-16
diffoscope JSON 1.08 108 2022-11-06
diffoscope JSON 1.04 104 2022-08-12
org.billthefarmer.gurgle Gurgle diffoscope JSON 1.29 129 2025-07-22
diffoscope JSON 1.28 128 2024-03-24
diffoscope JSON 1.27 127 2023-12-17
diffoscope JSON 1.24 124 2023-06-20
diffoscope JSON 1.22 122 2023-06-14
diffoscope JSON 1.21 121 2023-05-30
diffoscope JSON 1.20 120 2023-04-15
diffoscope JSON 1.19 119 2023-02-16
diffoscope JSON 1.18 118 2022-11-06
diffoscope JSON 1.12 112 2022-08-09
org.billthefarmer.melodeon Melodeon diffoscope JSON 1.19 119 2024-01-29
diffoscope JSON 1.18 118 2022-11-07
diffoscope JSON 1.15 115 2021-03-15
diffoscope JSON 1.15 115 2021-03-08
diffoscope JSON 1.14 114 2021-03-15
diffoscope JSON 1.14 114 2020-01-25
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.13 113 2019-12-22
diffoscope JSON 1.12 112 2021-03-15
diffoscope JSON 1.12 112 2019-01-16
diffoscope JSON 1.11 111 2021-03-15
diffoscope JSON 1.11 111 2018-12-07
diffoscope JSON 1.08 108 2021-03-15
diffoscope JSON 1.08 108 2018-10-17
org.billthefarmer.notes Notes diffoscope JSON 1.40 140 2024-07-01
diffoscope JSON 1.39 139 2024-03-10
diffoscope JSON 1.38 138 2023-11-25
diffoscope JSON 1.37 137 2023-09-11
diffoscope JSON 1.36 136 2023-09-02
diffoscope JSON 1.32 132 2022-12-16
diffoscope JSON 1.27 127 2022-08-11
diffoscope JSON 1.14 114 2021-05-29
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.13 113 2021-03-07
diffoscope JSON 1.06 106 2021-03-15
diffoscope JSON 1.06 106 2020-06-11
diffoscope JSON 1.05 105 2021-03-15
diffoscope JSON 1.05 105 2020-05-21
org.billthefarmer.print Print diffoscope JSON 1.08 108 2023-11-25
diffoscope JSON 1.07 107 2023-02-17
diffoscope JSON 1.06 106 2024-07-01
diffoscope JSON 1.05 105 2023-01-12
diffoscope JSON 1.04 104 2022-08-13
org.billthefarmer.scope Oscilloscope diffoscope JSON 1.38 138 2023-11-26
diffoscope JSON 1.37 137 2023-11-17
diffoscope JSON 1.36 136 2023-09-19
diffoscope JSON 1.34 134 2023-05-02
diffoscope JSON 1.33 133 2023-04-25
diffoscope JSON 1.32 132 2022-11-07
diffoscope JSON 1.31 131 2022-08-13
diffoscope JSON 1.28 128 2021-03-15
diffoscope JSON 1.28 128 2021-03-06
diffoscope JSON 1.26 126 2021-03-15
diffoscope JSON 1.26 126 2020-05-21
diffoscope JSON 1.25 125 2021-03-15
diffoscope JSON 1.25 125 2020-01-24
diffoscope JSON 1.24 124 2021-03-15
diffoscope JSON 1.24 124 2019-12-22
diffoscope JSON 1.21 121 2021-03-15
diffoscope JSON 1.21 121 2019-01-16
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.12 112 2021-03-15
org.billthefarmer.shorty Shorty diffoscope JSON 1.16 116 2022-11-07
diffoscope JSON 1.14 114 2021-03-15
diffoscope JSON 1.14 114 2021-03-09
diffoscope JSON 1.13 113 2021-03-15
diffoscope JSON 1.13 113 2020-05-21
diffoscope JSON 1.11 111 2021-03-15
diffoscope JSON 1.11 111 2019-12-22
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.10 110 2019-01-16
diffoscope JSON 1.08 108 2021-03-15
diffoscope JSON 1.07 107 2021-03-15
org.billthefarmer.siggen Signal Generator diffoscope JSON 1.36 136 2023-11-26
diffoscope JSON 1.35 135 2024-07-01
diffoscope JSON 1.34 134 2023-10-15
diffoscope JSON 1.33 133 2023-10-09
diffoscope JSON 1.32 132 2023-10-02
diffoscope JSON 1.31 131 2023-07-03
diffoscope JSON 1.29 129 2023-01-06
diffoscope JSON 1.28 128 2022-12-26
diffoscope JSON 1.27 127 2022-11-07
diffoscope JSON 1.26 126 2022-08-12
diffoscope JSON 1.22 122 2021-03-15
diffoscope JSON 1.22 122 2021-03-08
diffoscope JSON 1.21 121 2021-03-15
diffoscope JSON 1.21 121 2020-06-11
diffoscope JSON 1.20 120 2021-03-15
diffoscope JSON 1.20 120 2019-12-22
diffoscope JSON 1.19 119 2021-03-15
diffoscope JSON 1.19 119 2019-01-16
diffoscope JSON 1.12 112 2021-03-15
diffoscope JSON 1.10 110 2021-03-15
diffoscope JSON 1.09 109 2021-03-15
org.billthefarmer.solver WordleSolver diffoscope JSON 1.09 109 2023-12-05
diffoscope JSON 1.08 108 2023-10-26
diffoscope JSON 1.07 107 2023-07-07
diffoscope JSON 1.06 106 2023-06-24
diffoscope JSON 1.05 105 2023-05-30
diffoscope JSON 1.04 104 2022-11-08
diffoscope JSON 1.03 103 2022-08-14
org.billthefarmer.specie Specie diffoscope JSON 1.13 113 2023-11-26
diffoscope JSON 1.12 112 2023-10-07
diffoscope JSON 1.11 111 2023-08-31
diffoscope JSON 1.09 109 2023-07-10
diffoscope JSON 1.08 108 2023-02-14
diffoscope JSON 1.05 105 2022-08-14
org.billthefarmer.tuner Tuner diffoscope JSON 1.55 155 2023-11-25
diffoscope JSON 1.54 154 2024-07-01
diffoscope JSON 1.53 153 2023-10-16
diffoscope JSON 1.52 152 2023-09-19
diffoscope JSON 1.51 151 2023-05-28
diffoscope JSON 1.50 150 2023-03-06
diffoscope JSON 1.49 149 2023-02-25
diffoscope JSON 1.48 148 2023-02-15
diffoscope JSON 1.47 147 2022-11-07
diffoscope JSON 1.38 138 2021-03-15
diffoscope JSON 1.38 138 2021-03-09
diffoscope JSON 1.36 136 2021-03-15
diffoscope JSON 1.36 136 2020-05-21
diffoscope JSON 1.35 135 2021-03-15
diffoscope JSON 1.35 135 2020-01-24
diffoscope JSON 1.33 133 2021-03-15
diffoscope JSON 1.33 133 2019-12-22
diffoscope JSON 1.27 127 2021-03-15
diffoscope JSON 1.27 127 2019-01-16
diffoscope JSON 1.17 117 2021-03-15
diffoscope JSON 1.16 116 2021-03-15
diffoscope JSON 1.14 114 2021-03-15
org.birthdayadapter Birthday Adapter diffoscope JSON 2.0 19 2021-03-15
diffoscope JSON 2.0 19 2018-10-17
org.bitbucket.tickytacky.mirrormirror Mirror Mirror diffoscope JSON 1.0.3.1 5 2021-03-15
org.broeuschmeul.android.gps.usb.provider UsbGps4Droid diffoscope JSON v2.2.1 199 2021-03-15
diffoscope JSON v2.2.1 199 2021-03-11
diffoscope JSON v2.2.0 198 2021-03-15
diffoscope JSON v2.2.0 198 2020-05-21
org.ca.squawker Squawker diffoscope JSON 3.8.0 300015543 2024-04-08
org.calyxinstitute.vpn Calyx VPN diffoscope JSON 1.5.1 179000 2025-04-15
diffoscope JSON 1.3.0RC1 171000 2024-05-16
diffoscope JSON 1.2.0 170000 2024-02-24
diffoscope JSON 1.1.8-1 169001 2024-02-18
diffoscope JSON 1.0.3 147 2021-03-15
diffoscope JSON 1.0.3 147 2020-06-11
org.chrisbailey.todo ToDo List Widget diffoscope JSON 1.7.1 10 2021-03-15
diffoscope JSON 1.7.1 10 2018-10-17
org.ciasaboark.tacere Tacere diffoscope JSON 2.1.0 - beta 5 11 2021-03-15
diffoscope JSON 2.1.0 - beta 5 11 2018-10-17
org.cimbar.camerafilecopy CameraFileCopy diffoscope JSON 0.6.1 15 2024-03-09
diffoscope JSON 0.6.0f 13 2024-02-28
diffoscope JSON 0.5.15 11 2024-02-14
diffoscope JSON 0.5.14 10 2023-12-06
diffoscope JSON 0.5.13 9 2023-12-03
diffoscope JSON 0.5.12 8 2023-04-07
diffoscope JSON 0.5.11 7 2022-08-13
org.cipherdyne.fwknop2 Fwknop2 diffoscope JSON 1.2.3 32 2021-03-15
diffoscope JSON 1.2.3 32 2018-10-17
org.cmotc.tools.rotationlockpp Rotation Lock + Landscape diffoscope JSON 3.0 11 2021-03-15
diffoscope JSON 3.0 11 2018-10-17
org.codeberg.nykula.sapfir Sapfir diffoscope JSON 1.0.9 10 2025-07-17
diffoscope JSON 1.0.8 9 2025-07-16
org.commonvoice.saverio Donate your voice: CV Project diffoscope JSON 2.5.1 183 2023-05-22
diffoscope JSON 2.3.1 135 2021-04-04
diffoscope JSON 1.4.4 106 2021-03-15
diffoscope JSON 1.4.4 106 2020-06-11
org.connectbot ConnectBot diffoscope JSON 1.9.12-oss 10912000 2025-05-27
diffoscope JSON 1.9.6-oss 10906000 2021-03-15
diffoscope JSON 1.9.6-oss 10906000 2019-12-20
diffoscope JSON 1.9.5-oss 10905000 2021-03-15
diffoscope JSON 1.9.5-oss 10905000 2018-12-06
diffoscope JSON 1.9.2-oss 19200 2021-03-15
diffoscope JSON 1.9.2-oss 19200 2018-10-17
diffoscope JSON 1.9.1 19100 2021-03-15
diffoscope JSON 1.9.1 19100 2018-10-17
org.cosmicide Cosmic IDE diffoscope JSON 2.0.3 23 2023-10-18
org.courville.nova NOVA Video Player diffoscope JSON 6.4.3 6040003 2025-05-27
diffoscope JSON 6.3.28 6030028 2025-05-23
diffoscope JSON 6.3.23 6030023 2025-02-22
diffoscope JSON 6.2.57 602057 2024-02-14
diffoscope JSON 6.2.55 602055 2024-02-05
diffoscope JSON 6.2.50 602050 2024-01-15
diffoscope JSON 6.2.40 602040 2024-01-06
diffoscope JSON 6.2.35 602035 2023-11-25
diffoscope JSON 6.1.6 601006 2023-04-09
diffoscope JSON 6.0.97 600097 2023-02-14
diffoscope JSON 6.0.81 600081 2022-12-16
diffoscope JSON 6.0.71 600071 2022-08-12
diffoscope JSON 4.49.11 404911 2021-03-15
diffoscope JSON 4.49.11 404911 2021-03-10
org.covolunablu.marswallpaper Mars Live Wallpaper diffoscope JSON 1.2.0 3 2021-03-15
diffoscope JSON 1.2.0 3 2018-12-06
org.daylightingsociety.wherearetheeyes WhereAreTheEyes diffoscope JSON 1.3.0 6 2021-03-15
diffoscope JSON 1.3.0 6 2018-10-17
diffoscope JSON 1.2.1 5 2021-03-15
diffoscope JSON 1.2.1 5 2018-10-17
diffoscope JSON 1.2 4 2021-03-15
diffoscope JSON 1.2 4 2018-10-17
org.ddosolitary.okcagent OkcAgent diffoscope JSON 0.2.3 6 2021-03-15
diffoscope JSON 0.2.3 6 2021-03-10
org.debian.eugen.headingcalculator Heading Calculator diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
org.deluge.trireme Trireme for Deluge diffoscope JSON 1.4.3 27 2024-05-12
diffoscope JSON 1.0.3 11 2021-03-15
diffoscope JSON 1.0.3 11 2019-04-06
diffoscope JSON 0.9.1 7 2021-03-15
diffoscope JSON 0.9.1 7 2018-12-07
org.developfreedom.ccdroid.app CCDroid diffoscope JSON 0.0.2 2 2021-03-15
diffoscope JSON 0.0.2 2 2018-10-17
org.developfreedom.logmein LogMeIn diffoscope JSON 0.6.2 62 2021-03-15
diffoscope JSON 0.6.2 62 2018-10-17
org.developfreedom.wordpowermadeeasy Word Power Made Easy diffoscope JSON 0.1.6 16 2021-03-15
diffoscope JSON 0.1.6 16 2018-10-17
org.develz.crawl Dungeon Crawl Stone Soup diffoscope JSON 0.33.1 35 2025-06-16
diffoscope JSON 0.33.0-11-g5f24e6623a 34 2025-06-09
diffoscope JSON 0.32.1-1-g848d7226f3 33 2024-12-09
diffoscope JSON 0.32.1 32 2024-12-08
diffoscope JSON 0.32.0 31 2024-12-14
diffoscope JSON 0.31.0-12-g77e489cdc1 30 2024-02-26
org.disroot.disrootapp Disroot app diffoscope JSON 2.1.1 33 2024-05-10
diffoscope JSON 2.0.8 31 2023-11-25
diffoscope JSON 2.0.3 26 2022-01-09
diffoscope JSON 2.0.2 25 2021-03-15
diffoscope JSON 2.0.2 25 2021-03-14
diffoscope JSON 2.0.1 24 2021-03-15
diffoscope JSON 2.0.1 24 2020-05-21
diffoscope JSON 1.2.2 21 2021-03-15
diffoscope JSON 1.2.2 21 2019-12-21
diffoscope JSON 1.1.2 15 2021-03-15
diffoscope JSON 1.1.2 15 2019-01-16
diffoscope JSON 1.0.2 12 2021-03-15
diffoscope JSON 1.0.2 12 2018-12-06
org.documentfoundation.libreoffice LibreOffice Viewer diffoscope JSON 7.6.7.2 55 2024-05-15
diffoscope JSON 7.6.6.3 49 2024-03-31
diffoscope JSON 7.6.5.2 43 2024-02-26
diffoscope JSON 7.6.4.1/e19e193f88cd/F-Droid 38 2024-02-20
org.droidupnp DroidUPnP diffoscope JSON 2.4.1 18 2022-01-11
org.dyndns.fules.ck Compass Keyboard diffoscope JSON v1.6pre2 20 2021-03-15
diffoscope JSON v1.6pre2 20 2018-10-17
org.eehouse.android.xw4 CrossWords diffoscope JSON 4.4.204 200 2025-01-18
diffoscope JSON 4.4.203 199 2024-03-17
diffoscope JSON 4.4.202 198 2024-03-12
diffoscope JSON 4.4.201 197 2024-02-10
diffoscope JSON 4.4.199 195 2023-11-25
diffoscope JSON 4.4.198 194 2023-05-30
diffoscope JSON 4.4.197 193 2023-04-13
diffoscope JSON 4.4.196 192 2023-02-15
diffoscope JSON 4.4.193 190 2022-12-16
diffoscope JSON 4.4.188 185 2022-08-13
diffoscope JSON 4.4.174 170 2021-03-15
diffoscope JSON 4.4.174 170 2021-03-06
diffoscope JSON 4.4.154 150 2021-03-15
diffoscope JSON 4.4.154 150 2020-01-24
diffoscope JSON 4.4.149 145 2021-03-15
diffoscope JSON 4.4.149 145 2019-12-20
diffoscope JSON 4.4.148 144 2021-03-15
diffoscope JSON 4.4.148 144 2019-09-12
diffoscope JSON 4.4.147 143 2021-03-15
diffoscope JSON 4.4.147 143 2019-07-02
diffoscope JSON 4.4.119 115 2021-03-15
diffoscope JSON 4.4.119 115 2018-10-17
org.elijaxapps.androidxmrigminer Android XMRig Miner diffoscope JSON 1.02 5 2021-03-15
diffoscope JSON 1.02 5 2018-12-07
org.emunix.insteadlauncher INSTEAD diffoscope JSON 0.9.2 90200 2024-12-14
diffoscope JSON 0.8.5 80500 2021-04-05
diffoscope JSON 0.8.2 802 2021-03-15
diffoscope JSON 0.8.2 802 2020-05-21
org.example.rosary Rosary diffoscope JSON 0.2.1 3 2021-03-15
org.exarhteam.iitc_mobile IITC-CE Mobile diffoscope JSON 0.40.0 1745065918 2025-04-30
diffoscope JSON 0.39.1 1729769456 2024-12-07
diffoscope JSON 0.39.0 1729261541 2024-12-03
diffoscope JSON 0.38.1 1710945781 2024-03-24
diffoscope JSON 0.38.0 1708679645 2024-02-24
diffoscope JSON 0.37.2 1707810442 2024-02-18
diffoscope JSON 0.37.1 1700222615 2023-11-24
diffoscope JSON 0.37.0 1697652120 2023-10-21
diffoscope JSON 0.36.1 1691435831 2023-08-31
diffoscope JSON 0.35.1 1686730183 2023-06-20
diffoscope JSON 0.35.0 1680026393 2023-04-04
diffoscope JSON 0.34.1 1671114185 2022-12-19
diffoscope JSON 0.34.0 1668687390 2022-12-15
diffoscope JSON 0.33.0 1658941276 2022-08-10
org.fitchfamily.android.wifi_backend LocalWifiNlpBackend diffoscope JSON 1.1.10 39 2021-03-15
diffoscope JSON 1.1.10 39 2018-10-17
org.fossasia.badgemagic Badge Magic diffoscope JSON 1.11.63 246 2025-03-13
org.framasoft.peertube PeerTube diffoscope JSON 1.0.1 20 2025-05-08
diffoscope JSON 0.6.0 18 2025-02-01
org.freedombox.freedombox FreedomBox diffoscope JSON 0.7 9 2024-12-17
diffoscope JSON 0.5 5 2021-03-15
diffoscope JSON 0.5 5 2019-12-22
org.freeminer.freeminer freeminer diffoscope JSON 5.10.0 5100000 2025-03-07
org.fsociety.vernet Vernet - Network Analyzer diffoscope JSON 1.2.1 37 2025-05-23
diffoscope JSON 1.1.0 33 2025-03-05
diffoscope JSON 1.0.2 17 2024-02-19
org.glucosio.android Glucosio diffoscope JSON 1.3.0-FOSS 38 2021-03-15
diffoscope JSON 1.3.0-FOSS 38 2018-10-17
org.gnu.emacs Emacs diffoscope JSON 30.1 300100003 2025-03-17
diffoscope JSON 30.1 300100002 2025-03-09
diffoscope JSON 30.1 300100001 2025-03-08
diffoscope JSON 30.1 300100000 2025-03-05
diffoscope JSON 30.0.93 300093013 2025-03-04
diffoscope JSON 30.0.93 300093012 2025-03-03
diffoscope JSON 30.0.93 300093011 2025-03-02
diffoscope JSON 30.0.93 300093010 2025-02-21
diffoscope JSON 30.0.93 300093003 2025-03-01
diffoscope JSON 30.0.93 300093002 2025-02-27
diffoscope JSON 30.0.93 300093001 2025-02-23
diffoscope JSON 30.0.93 300093000 2025-02-01
diffoscope JSON 30.0.50 300050033 2024-02-14
org.godotengine.editor.v4 Godot Engine 4 diffoscope JSON 4.4.1.stable 404015003 2025-06-13
diffoscope JSON 4.4.1.stable 404015002 2025-06-12
diffoscope JSON 4.4.1.stable 404015001 2025-06-10
diffoscope JSON 4.4.1.stable 404015000 2025-06-09
diffoscope JSON 4.3.0.stable 403005003 2025-04-22
diffoscope JSON 4.3.0.stable 403005002 2025-04-21
diffoscope JSON 4.3.0.stable 403005001 2024-12-17
diffoscope JSON 4.3.0.stable 403005000 2024-12-17
diffoscope JSON 4.1.2.stable 402024003 2023-11-27
org.gsmlg.semaphore Ansible Sempahore Client diffoscope JSON 1.0.0 13 2024-02-21
org.happysanta.gd Gravity Defied diffoscope JSON 1.1.1 29 2021-03-15
diffoscope JSON 1.1.1 29 2018-10-17
org.herrlado.ask.languagepack.czech Czech for AnySoftKeyboard diffoscope JSON 2.0.1 259 2021-03-15
org.hiittimer.hiittimer HIIT Timer diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
org.holylobster.nuntius Nuntius diffoscope JSON 1.1 4 2021-03-15
diffoscope JSON 1.1 4 2018-10-17
org.icasdri.mather Mather diffoscope JSON 0.3.0 300 2021-03-15
diffoscope JSON 0.3.0 300 2018-10-17
org.irmacard.cardemu Yivi diffoscope JSON 7.5.5 4194469 2024-02-20
diffoscope JSON 6.3.0 142 2022-08-11
org.ironrabbit Tibetan Pad diffoscope JSON 0.0.6 6 2021-03-15
diffoscope JSON 0.0.6 6 2018-10-17
org.itxtech.daedalus Daedalus diffoscope JSON 1.15.0 21 2022-08-12
org.jfedor.frozenbubble Frozen Bubble diffoscope JSON 4.4 54 2021-03-15
diffoscope JSON 4.4 54 2018-10-17
diffoscope JSON 4.1 51 2021-03-15
diffoscope JSON 4.1 51 2018-10-17
org.jfet.batsHIIT Bats! HIIT diffoscope JSON 1.08060461 6 2021-03-15
org.jsl.shmp ShellsMP diffoscope JSON 1.0 1 2021-03-15
org.jsl.wfwt WiFi Walkie Talkie diffoscope JSON 1.14 17 2025-03-15
diffoscope JSON 1.11 14 2021-03-15
org.katsarov.heatcalc HeatCalc diffoscope JSON 1.1.2 10102 2021-03-15
diffoscope JSON 1.1.2 10102 2018-10-17
org.kde.kdeconnect_tp KDE Connect diffoscope JSON 1.33.4 13304 2025-05-08
diffoscope JSON 1.33.3 13303 2025-04-15
diffoscope JSON 1.33.2 13302 2025-03-15
diffoscope JSON 1.33.1 13301 2025-03-10
diffoscope JSON 1.33.0 13300 2025-03-03
diffoscope JSON 1.32.11 13211 2025-02-03
diffoscope JSON 1.32.10 13210 2025-01-20
diffoscope JSON 1.32.9 13209 2024-12-07
diffoscope JSON 1.32.7 13207 2024-12-14
diffoscope JSON 1.32.5 13205 2024-12-10
diffoscope JSON 1.32.5 13205 2024-12-09
diffoscope JSON 1.29.0 12900 2023-09-22
diffoscope JSON 1.28.0 12801 2023-09-18
diffoscope JSON 1.27.1 12701 2023-09-01
diffoscope JSON 1.24.2 12402 2023-04-26
diffoscope JSON 1.24.1 12401 2023-04-18
diffoscope JSON 1.24.0 12400 2023-04-09
diffoscope JSON 1.23.2 12302 2023-03-22
diffoscope JSON 1.23.0 12300 2023-03-19
diffoscope JSON 1.22.2 12202 2023-02-15
diffoscope JSON 1.21.1 12101 2023-01-10
diffoscope JSON 1.21.0 12100 2023-01-04
diffoscope JSON 1.20.2 12002 2022-12-31
diffoscope JSON 1.19.1 11910 2022-08-15
diffoscope JSON 1.17.0 11700 2021-05-30
diffoscope JSON 1.16.0 11600 2021-03-15
diffoscope JSON 1.16.0 11600 2021-03-08
diffoscope JSON 1.14.2 11421 2021-03-15
diffoscope JSON 1.14.2 11421 2020-05-21
diffoscope JSON 1.10.1 11010 2021-03-15
diffoscope JSON 1.10.1 11010 2018-12-06
diffoscope JSON 1.6.6 1660 2021-03-15
diffoscope JSON 1.6.3 1630 2021-03-15
diffoscope JSON 1.6.1 1610 2021-03-15
org.kontalk Kontalk Messenger diffoscope JSON 4.4.0 500 2021-03-15
diffoscope JSON 4.3.1 440 2021-03-15
diffoscope JSON 4.3.1 440 2019-12-22
diffoscope JSON 4.1.0-beta4 250 2021-03-15
org.kore.kolabnotes.android Kolab Notes diffoscope JSON 5.0.1 107 2023-10-10
diffoscope JSON 3.2.1 100 2021-03-15
diffoscope JSON 3.2.1 100 2019-09-12
diffoscope JSON 3.2.0 99 2021-03-15
diffoscope JSON 3.2.0 99 2018-12-06
org.koreader.launcher.fdroid KOReader diffoscope JSON v2025.04 111133 2025-04-17
diffoscope JSON v2025.04 111132 2025-04-16
diffoscope JSON v2025.04 111131 2025-04-15
diffoscope JSON v2024.11 108123 2025-05-02
diffoscope JSON v2024.11 108122 2024-12-17
diffoscope JSON v2024.11 108121 2024-12-14
diffoscope JSON v2024.03.1 102163 2024-03-10
diffoscope JSON v2024.03 102143 2024-03-07
diffoscope JSON v2024.01 101333 2024-02-20
org.krita Krita diffoscope JSON 5.1.5 5011804 2023-02-17
diffoscope JSON 5.1.3 5011604 2022-12-16
diffoscope JSON 5.0.6 4050008 2022-08-13
diffoscope JSON 4.4.2 4040404 2021-03-15
diffoscope JSON 4.4.2 4040404 2021-03-07
org.legtux.m_316k.fortune Fortunes diffoscope JSON 2.0 2 2021-03-15
org.lf_net.pgpunlocker PGPAuth diffoscope JSON 1.7.1 2017051001 2021-03-15
org.libreoffice.impressremote Impress Remote diffoscope JSON 2.6.0 28 2023-02-17
org.ligi.ajsha AJShA Android Java Shell App diffoscope JSON 0.12 12 2021-03-15
diffoscope JSON 0.12 12 2018-10-17
org.ligi.blexplorer BLExplorer diffoscope JSON 1.2 12 2021-03-15
diffoscope JSON 1.2 12 2018-10-17
org.ligi.gobandroid_hd Gobandroid diffoscope JSON 2.5.8 258 2021-03-15
diffoscope JSON 2.5.8 258 2018-10-17
diffoscope JSON 2.5.3 253 2021-03-15
diffoscope JSON 2.5.3 253 2018-10-17
org.ligi.ipfsdroid IPFSDroid diffoscope JSON 0.10 10 2021-03-15
diffoscope JSON 0.10 10 2018-10-17
org.ligi.materialteatimer Material Tea Timer diffoscope JSON 1.4 14 2021-03-15
diffoscope JSON 1.4 14 2018-10-17
diffoscope JSON 1.3 13 2021-03-15
diffoscope JSON 1.3 13 2018-10-17
org.ligi.satoshiproof Satoshi Proof diffoscope JSON 1.0.4 104 2021-03-15
diffoscope JSON 1.0.4 104 2018-10-17
org.linphone Linphone - open source SIP client diffoscope JSON 5.2.3 520033 2024-02-18
diffoscope JSON 5.2.2 520023 2024-01-19
diffoscope JSON 5.1.4 510403 2023-12-01
diffoscope JSON 5.0.8 500083 2023-03-31
diffoscope JSON 4.3.1 4310 2021-03-15
diffoscope JSON 4.3.1 4310 2021-03-11
diffoscope JSON 4.2.0-beta 4200 2021-03-15
diffoscope JSON 4.2.0-beta 4200 2019-12-21
org.lufebe16.freecell FreeCell4 diffoscope JSON 1.9 1021109 2023-12-29
org.lufebe16.lbalance LBalance diffoscope JSON 1.0 1021100 2023-12-02
org.lufebe16.pysolfc PySolFC diffoscope JSON 2.24.0 102122400 2024-03-18
diffoscope JSON 2.20.1 102122001 2023-05-03
diffoscope JSON 2.20.0 102122000 2023-03-04
diffoscope JSON 2.18.0 102121800 2022-12-15
diffoscope JSON 2.8.0 72120800 2021-03-15
diffoscope JSON 2.6.4 72120604 2021-03-15
diffoscope JSON 2.6.4 72120604 2019-12-21
org.lumicall.android Lumicall diffoscope JSON 1.13.3 192 2022-01-10
diffoscope JSON 1.13.2 191 2021-05-30
diffoscope JSON 1.13.0 189 2021-03-15
diffoscope JSON 1.13.0 189 2018-10-17
diffoscope JSON 1.12.16 188 2021-03-15
diffoscope JSON 1.12.16 188 2018-10-17
org.mcxa.softsound Soft Sound diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2019-07-11
org.mcxa.zephyrlogger ZephyrLogger diffoscope JSON 1.0 1 2021-03-15
org.microg.nlp UnifiedNlp (GAPPS) diffoscope JSON 1.6.8 20187 2021-03-15
diffoscope JSON 1.6.8 20187 2018-10-17
org.microg.nlp.backend.apple Apple UnifiedNlp Backend diffoscope JSON 1.2.2 20038 2021-03-15
diffoscope JSON 1.2.2 20038 2018-10-17
org.microg.nlp.backend.nominatim NominatimNlpBackend diffoscope JSON 1.2.2 20042 2021-03-15
diffoscope JSON 1.2.2 20042 2018-10-17
diffoscope JSON 1.2.1 20039 2021-03-15
org.mosad.seil0.projectlaogai ProjectLaogai diffoscope JSON 0.6.0 6000 2021-03-15
diffoscope JSON 0.6.0 6000 2021-03-11
diffoscope JSON 0.5.1 15 2021-03-15
diffoscope JSON 0.5.1 15 2020-06-11
diffoscope JSON 0.5.0 14 2021-03-15
diffoscope JSON 0.5.0 14 2019-12-21
org.mosad.teapod Teapod diffoscope JSON 1.1.0-beta1 100990 2023-02-24
diffoscope JSON 1.0.0 100000 2022-11-05
diffoscope JSON 1.0.0-beta2 9010 2022-08-12
diffoscope JSON 0.4.1 4100 2021-03-16
diffoscope JSON 0.4.0 4000 2021-03-15
org.mozilla.fennec_fdroid Fennec F-Droid diffoscope JSON 68.8.0 688020 2021-03-15
diffoscope JSON 68.8.0 688020 2020-05-21
diffoscope JSON 68.4.1 684120 2021-03-15
diffoscope JSON 68.4.1 684120 2020-01-24
diffoscope JSON 63.0.2 630210 2021-03-15
diffoscope JSON 63.0.2 630210 2018-12-06
diffoscope JSON 57.0 570020 2021-03-15
diffoscope JSON 57.0 570020 2018-10-17
diffoscope JSON 51.0 510010 2021-03-15
diffoscope JSON 51.0 510010 2018-10-17
diffoscope JSON 50.1.0 501010 2021-03-15
diffoscope JSON 50.1.0 501010 2018-10-17
org.mupen64plusae.v3.alpha Mupen64Plus AE diffoscope JSON 3.0.246 (beta) 246 2021-03-15
org.musicpd MPD diffoscope JSON 0.23.17 75 2025-02-05
diffoscope JSON 0.23.15 73 2023-12-24
diffoscope JSON 0.23.14 72 2023-11-27
diffoscope JSON 0.23.12 71 2023-02-17
diffoscope JSON 0.23.11 70 2022-12-14
diffoscope JSON 0.23.10 69 2022-11-05
org.navitproject.navit Navit diffoscope JSON v0.5.6 2021030660 2021-03-15
diffoscope JSON v0.5.6 2021030660 2021-03-12
org.ncrmnt.nettts NetTTS diffoscope JSON 0.2.1 3 2021-03-15
diffoscope JSON 0.2.1 3 2018-10-17
org.ndeftools.boilerplate NDEF Tools for Android diffoscope JSON 1.3 3 2021-03-15
diffoscope JSON 1.3 3 2018-10-17
org.noise_planet.noisecapture NoiseCapture diffoscope JSON 1.3.1 65 2025-07-17
diffoscope JSON 1.2.22 58 2022-08-14
org.nuntius35.wrongpinshutdown Wrong PIN Shutdown diffoscope JSON 12 12 2021-03-15
diffoscope JSON 12 12 2020-05-22
diffoscope JSON 10 10 2021-03-15
diffoscope JSON 10 10 2019-12-23
diffoscope JSON 8 8 2021-03-15
diffoscope JSON 8 8 2018-12-06
diffoscope JSON 4 4 2021-03-15
diffoscope JSON 3 3 2021-03-15
org.og8.a1tox 1toX diffoscope JSON 1.00 1 2021-03-15
diffoscope JSON 1.00 1 2019-09-11
org.opengemara.shiurim Shiurim diffoscope JSON 0.1.3 4 2021-03-15
diffoscope JSON 0.1.3 4 2018-10-17
org.openhab.habdroid openHAB diffoscope JSON 3.17.2 565 2025-02-21
diffoscope JSON 3.17.1 564 2025-02-05
diffoscope JSON 3.17.0 563 2025-01-27
diffoscope JSON 3.11.0 520 2024-03-12
diffoscope JSON 3.10.0 514 2024-02-02
diffoscope JSON 3.9.0 511 2024-01-20
diffoscope JSON 3.8.0 504 2023-12-16
diffoscope JSON 3.7.0 493 2023-09-03
diffoscope JSON 3.5.0 486 2023-05-07
diffoscope JSON 3.4.0 479 2023-03-31
diffoscope JSON 3.3.1 473 2023-02-26
diffoscope JSON 3.2.0 467 2023-02-15
diffoscope JSON 3.0.0 454 2023-01-13
diffoscope JSON 2.23.0 442 2022-11-05
diffoscope JSON 2.22.0 437 2022-08-09
diffoscope JSON 2.17.0 378 2021-05-29
diffoscope JSON 2.16.1 357 2021-03-15
diffoscope JSON 2.11.0 232 2021-03-15
diffoscope JSON 2.11.0 232 2020-01-25
diffoscope JSON 2.10.3 214 2021-03-15
diffoscope JSON 2.10.3 214 2019-12-21
diffoscope JSON 2.5.0 95 2021-03-15
diffoscope JSON 2.5.0 95 2018-12-06
org.openobservatory.ooniprobe OONI Probe diffoscope JSON 5.1.0 214 2025-07-18
diffoscope JSON 5.1.0 213 2025-07-17
diffoscope JSON 5.1.0 212 2025-07-16
diffoscope JSON 5.1.0 211 2025-07-15
diffoscope JSON 4.0.0 122 2024-12-07
diffoscope JSON 3.8.4 106 2023-11-27
diffoscope JSON 3.8.2 100 2023-05-21
diffoscope JSON 3.7.3 95 2022-12-24
org.openpetfoodfacts.scanner Open Pet Food Facts diffoscope JSON 3.9.0 582 2022-12-20
diffoscope JSON 3.6.8 433 2021-04-04
diffoscope JSON 3.2.8 328 2021-03-15
diffoscope JSON 3.2.8 328 2020-05-22
diffoscope JSON 3.2.5 325 2021-03-15
diffoscope JSON 3.2.5 325 2019-12-21
diffoscope JSON 2.9.8 298 2021-03-15
diffoscope JSON 2.9.8 298 2019-01-16
diffoscope JSON 0.7.4 37 2021-03-15
diffoscope JSON 0.7.4 37 2018-10-17
org.opensurge2d.surgeengine Open Surge: retro game engine diffoscope JSON 6.1.0.0-fdroid 30500 2024-05-16
org.openttd.fdroid OpenTTD diffoscope JSON 13.4.rev120 1340120 2024-03-17
diffoscope JSON 12.2.rev112 1220112 2022-08-11
org.osmdroid Open Map diffoscope JSON 6.1.18 54 2024-01-07
diffoscope JSON 6.1.17 53 2023-09-19
diffoscope JSON 6.1.16 52 2023-04-04
diffoscope JSON 6.1.15 51 2023-04-01
diffoscope JSON 6.1.14 50 2022-11-08
org.outline.android.client Outline diffoscope JSON 1.12.1 43 2024-05-16
diffoscope JSON 1.8.1 42 2024-02-14
org.owntracks.android OwnTracks diffoscope JSON 2.5.3 420503003 2024-12-10
diffoscope JSON 2.4.9 20409000 2022-08-12
org.pacien.tincapp Tinc Mesh VPN diffoscope JSON 0.42 42 2024-12-09
diffoscope JSON 0.41 41 2024-12-10
diffoscope JSON 0.39 39 2024-01-22
diffoscope JSON 0.37 37 2023-02-16
diffoscope JSON 0.36 36 2023-01-10
diffoscope JSON 0.35 35 2023-01-08
diffoscope JSON 0.34 34 2023-01-06
diffoscope JSON 0.32 32 2021-03-15
diffoscope JSON 0.30 30 2021-03-15
diffoscope JSON 0.30 30 2020-01-25
diffoscope JSON 0.23 23 2021-03-15
diffoscope JSON 0.23 23 2018-12-07
org.passwordmaker.android PasswordMaker Pro diffoscope JSON 1.1.11 11 2021-03-15
diffoscope JSON 1.1.11 11 2018-10-17
org.pgnapps.pk2 Pekka Kana 2 diffoscope JSON 1.4.5 1029 2023-04-28
diffoscope JSON 1.4.2 1026 2022-01-09
org.phramusca.jamuz JaMuz diffoscope JSON 0.6.7 15 2023-02-21
diffoscope JSON 0.6.6 14 2022-12-26
diffoscope JSON 0.6.5 13 2022-12-14
org.pipoypipagames.towerjumper TowerJumper diffoscope JSON 1.0.8 13 2021-03-15
diffoscope JSON 1.0.8 13 2019-04-06
diffoscope JSON 1.0.7 12 2021-03-15
diffoscope JSON 1.0.7 12 2019-01-16
org.pixeldroid.app PixelDroid diffoscope JSON 1.0.beta40 4004 2025-02-28
diffoscope JSON 1.0.beta40 4003 2025-02-27
diffoscope JSON 1.0.beta40 4002 2025-02-26
diffoscope JSON 1.0.beta40 4001 2025-02-22
diffoscope JSON 1.0.beta39 3904 2025-04-28
diffoscope JSON 1.0.beta39 3903 2025-04-27
diffoscope JSON 1.0.beta39 3901 2025-04-23
diffoscope JSON 1.0.beta38 3801 2024-12-07
diffoscope JSON 1.0.beta32 32 2024-03-06
diffoscope JSON 1.0.beta31 31 2024-02-28
diffoscope JSON 1.0.beta30 30 2024-02-18
diffoscope JSON 1.0.beta29 29 2024-02-14
diffoscope JSON 1.0.beta27 27 2024-01-29
diffoscope JSON 1.0.beta26 26 2024-01-06
diffoscope JSON 1.0.beta25 25 2024-01-01
diffoscope JSON 1.0.beta24 24 2023-09-03
org.pocketworkstation.pckeyboard Hacker's Keyboard diffoscope JSON v1.41.1 1041001 2021-03-15
diffoscope JSON v1.41.1 1041001 2019-01-16
diffoscope JSON v1.39.3 1039003 2021-03-15
diffoscope JSON v1.39.3 1039003 2018-10-17
org.privacyhelper Privacy Helper diffoscope JSON 0.7 8 2021-03-15
diffoscope JSON 0.7 8 2019-01-16
diffoscope JSON 0.6 7 2021-03-15
diffoscope JSON 0.6 7 2018-12-06
org.projectmaxs.main MAXS Main diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.alarmset MAXS Module AlarmSet diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.bluetooth MAXS Module Bluetooth diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.bluetoothadmin MAXS Module BluetoothAdmin diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.clipboard MAXS Module Clipboard diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.contactsread MAXS Module ContactsRead diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.fileread MAXS Module FileRead diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.filewrite MAXS Module FileWrite diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.locationfine MAXS Module LocationFine diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.misc MAXS Module Misc diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.nfc MAXS Module NFC diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.12 2000503575 2021-03-10
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.notification MAXS Module Notification diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.phonestateread MAXS Module PhonestateRead diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.ringermode MAXS Module Ringermode diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.shell MAXS Module Shell diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.smsnotify MAXS Module SmsNotify diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.smsread MAXS Module SmsRead diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.smssend MAXS Module SmsSend diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.smswrite MAXS Module SmsWrite diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.wifiaccess MAXS Module WifiAccess diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.module.wifichange MAXS Module WifiChange diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectmaxs.transport.xmpp MAXS Transport XMPP diffoscope JSON 0.5.17 2000504755 2022-08-11
diffoscope JSON 0.5.14 2000503969 2022-01-12
diffoscope JSON 0.5.13 2000503857 2021-05-31
diffoscope JSON 0.5.12 2000503575 2021-03-15
diffoscope JSON 0.5.8 2000502507 2021-03-15
diffoscope JSON 0.5.8 2000502507 2019-12-22
org.projectvoodoo.simplecarrieriqdetector Voodoo CarrierIQ Detector diffoscope JSON 2.0.4 16 2021-03-15
diffoscope JSON 2.0.4 16 2018-10-17
org.proninyaroslav.blink_comparison Blink Comparison diffoscope JSON 1.1.1 5 2022-03-10
diffoscope JSON 1.0.1 2 2022-01-08
org.proninyaroslav.libretrack LibreTrack diffoscope JSON 1.7.0 6132 2025-01-21
diffoscope JSON 1.7.0 6131 2025-01-18
diffoscope JSON 1.3.0 5 2022-01-11
org.purple.smoke Smoke diffoscope JSON 2024.01.05 20240105 2024-01-06
diffoscope JSON 2023.12.25 20231225 2023-12-28
diffoscope JSON 2023.05.10 20230510 2023-05-12
diffoscope JSON 2023.04.05 20230405 2023-04-08
diffoscope JSON 2023.03.30 20230330 2023-04-02
diffoscope JSON 2023.03.15 20230315 2023-03-16
diffoscope JSON 2023.03.10 20230310 2023-03-13
diffoscope JSON 2023.01.10 20230110 2023-01-12
diffoscope JSON 2023.01.07 20230107 2023-01-08
diffoscope JSON 2023.01.05 20230105 2023-01-07
diffoscope JSON 2022.11.15 20221115 2022-12-15
diffoscope JSON 2022.04.10 20220410 2022-08-14
diffoscope JSON 2021.03.20 20210320 2021-04-04
diffoscope JSON 2021.02.25 20210225 2021-03-15
diffoscope JSON 2021.02.25 20210225 2021-03-12
org.purple.smokestack SmokeStack diffoscope JSON 2024.01.01 20240101 2024-01-06
diffoscope JSON 2023.12.25 20231225 2023-12-29
diffoscope JSON 2022.04.20 20220420 2022-08-14
org.purplei2p.i2pd i2pd diffoscope JSON 2.51.0 2510000 2024-04-10
diffoscope JSON 2.42.1 2420100 2022-08-13
org.pyneo.maps Tabulae diffoscope JSON 1.0.10 10010 2021-03-15
diffoscope JSON 1.0.10 10010 2018-10-17
org.quentin_bettoum.librememorygame Libre Memory Game diffoscope JSON 1.1.0 8 2025-01-31
diffoscope JSON 1.0.6 7 2024-12-14
diffoscope JSON 1.0.2 3 2024-01-30
diffoscope JSON 1.0.1 2 2024-01-05
org.quovadit.apps.andof anDOF diffoscope JSON 2.3 21 2021-03-15
diffoscope JSON 2.3 21 2018-10-17
org.radar.app Radar App diffoscope JSON 0.8 80002 2024-02-20
org.redcross.openmapkit OpenMapKit diffoscope JSON 1.2 23 2021-03-15
org.revengate.revengate Revengate diffoscope JSON 0.13.0 2001300 2025-05-03
diffoscope JSON 0.12.6 1028126 2024-05-16
diffoscope JSON 0.12.1 1028121 2024-03-10
diffoscope JSON 0.12.0 1027141 2024-02-25
diffoscope JSON 0.11.6 1027140 2024-02-06
diffoscope JSON 0.11.5 1027139 2024-01-20
diffoscope JSON 0.11.3 1027137 2024-01-05
diffoscope JSON 0.11.2 1027136 2023-12-29
diffoscope JSON 0.11.1 1027135 2023-12-24
diffoscope JSON 0.11.0 1027134 2023-11-25
org.sajeg.fallingblocks Falling Blocks diffoscope JSON 1.8.2 16 2024-01-12
diffoscope JSON 1.7.2 8 2023-12-02
diffoscope JSON 1.6.1 5 2023-05-07
diffoscope JSON 1.5.1 3 2023-03-13
diffoscope JSON 1.5 2 2023-03-09
org.sasehash.burgerwp Live Burger Wallpaper diffoscope JSON 1.2.2 122 2021-03-15
diffoscope JSON 1.2.2 122 2019-07-02
org.schabi.kiba KIBA diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
org.schabi.nxbookmarks Nextcloud Bookmarks diffoscope JSON 1.24 24 2023-10-08
diffoscope JSON 1.23 23 2023-05-20
diffoscope JSON 1.21 21 2023-02-28
diffoscope JSON 1.20 20 2023-02-22
diffoscope JSON 1.19 19 2023-02-20
diffoscope JSON 1.2 3 2021-03-15
org.schabi.svgredirect SVG redirect diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
org.schabi.terminightor Terminightor diffoscope JSON 1.0.2 12 2021-03-15
diffoscope JSON 1.0.2 12 2018-10-17
org.secuso.privacyfriendlyactivitytracker Pedometer (PFA) diffoscope JSON 3.1.1 17 2025-04-30
diffoscope JSON 1.0.4 5 2021-03-15
org.secuso.privacyfriendlynotes Notes (PFA) diffoscope JSON 2.0.4 23 2025-04-30
diffoscope JSON 2.0.3 22 2025-04-23
diffoscope JSON 1.4.5 18 2024-01-16
diffoscope JSON 1.4.4 17 2023-11-26
diffoscope JSON 1.4.2 15 2023-05-13
diffoscope JSON 1.4.1 14 2022-12-14
diffoscope JSON 1.3.0 12 2022-11-08
diffoscope JSON 1.2.5 11 2022-08-09
diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2018-10-17
org.secuso.privacyfriendlypasswordgenerator Password Generator (PFA) diffoscope JSON 1.3.3 100 2025-07-26
diffoscope JSON 1.3.0 7 2023-09-16
diffoscope JSON 1.0.3 4 2021-03-15
diffoscope JSON 1.0.3 4 2019-12-22
diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
org.secuso.privacyfriendlysolitaire Solitaire (Privacy Friendly) diffoscope JSON 1.1 4 2023-10-12
org.segin.bfinterpreter BF Interpreter diffoscope JSON 0.7 7 2021-03-15
diffoscope JSON 0.7 7 2018-10-17
org.segin.ttleditor TTL Editor diffoscope JSON 1.0.15 19 2022-01-12
diffoscope JSON 1.0.14 18 2021-03-15
diffoscope JSON 1.0.14 18 2018-10-17
org.sensorkraken Sensorkraken diffoscope JSON 1.0.1 101 2023-09-19
diffoscope JSON 1.0 1 2022-12-16
org.sensors2.pd Sensors2Pd diffoscope JSON 0.3.1 4 2022-11-07
diffoscope JSON 0.1.0 1 2021-03-15
org.servalproject Serval Mesh diffoscope JSON 0.91 2120 2021-03-15
diffoscope JSON 0.91 2120 2018-10-17
org.simlar Simlar - secure calls diffoscope JSON 2.11.0 (alwaysOnline) 211003 2024-01-05
diffoscope JSON 2.10.1 (alwaysOnline) 210013 2023-12-24
diffoscope JSON 2.10.0 (alwaysOnline) 210003 2023-11-25
diffoscope JSON 2.8.1 (alwaysOnline) 20801 2023-02-16
diffoscope JSON 2.7.2 (alwaysOnline) 74 2022-12-15
diffoscope JSON 2.5.5 (alwaysOnline) 70 2022-08-15
org.smblott.intentradio IntentRadio diffoscope JSON 1.9.11 21 2021-03-15
diffoscope JSON 1.9.11 21 2018-10-17
org.smc.inputmethod.indic Indic Keyboard diffoscope JSON 3.5.1 103 2024-02-22
diffoscope JSON 2.0.5 25 2021-03-15
org.smssecure.smssecure Silence diffoscope JSON 0.16.12-unstable 211 2021-03-15
diffoscope JSON 0.16.12-unstable 211 2019-12-20
diffoscope JSON 0.16.9-unstable 208 2021-03-15
diffoscope JSON 0.16.9-unstable 208 2018-12-06
diffoscope JSON 0.16.8-unstable 207 2021-03-15
diffoscope JSON 0.16.6-unstable 205 2021-03-15
diffoscope JSON 0.16.5-unstable 204 2021-03-15
diffoscope JSON 0.16.4-unstable 203 2021-03-15
diffoscope JSON 0.16.3-unstable 202 2021-03-15
diffoscope JSON 0.16.3-unstable 202 2018-10-17
org.softeg.slartus.forpdaplus ForPDA diffoscope JSON 3.6.6 680 2024-04-12
diffoscope JSON 3.6.4 678 2023-06-14
diffoscope JSON 3.5.4.8 629 2021-03-15
diffoscope JSON 3.5.4.8 629 2019-12-21
diffoscope JSON 3.4.8.2 596 2021-03-15
diffoscope JSON 3.4.8.2 596 2018-10-17
diffoscope JSON 3.4.8 594 2021-03-15
org.solovyev.android.calculator Calculator++ diffoscope JSON 2.3.3 161 2023-11-25
diffoscope JSON 2.2.7 158 2021-03-15
diffoscope JSON 2.2.7 158 2020-05-22
org.stingle.photos Stingle Photos diffoscope JSON 2.11.0 57 2023-10-22
diffoscope JSON 2.10.2 54 2023-04-11
diffoscope JSON 2.10.1 53 2023-04-08
diffoscope JSON 2.9.0 51 2022-08-15
org.strawberryforum.pollywog Pollywog diffoscope JSON 0.1 1 2021-03-15
diffoscope JSON 0.1 1 2018-10-17
org.stypox.dicio Dicio assistant diffoscope JSON 3.2 16 2025-07-16
diffoscope JSON 3.1 15 2025-04-15
diffoscope JSON 2.0 13 2024-12-10
diffoscope JSON 0.9 9 2023-02-16
org.surrel.facebooknotifications Notifications for Facebook diffoscope JSON 1.10.0 13 2021-03-15
diffoscope JSON 1.10.0 13 2018-10-17
diffoscope JSON 1.9.2 12 2021-03-15
diffoscope JSON 1.9.2 12 2018-10-17
org.systemcall.scores Card Game Scores diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
org.t2.synconwifi SyncOnWifi diffoscope JSON 1.0.2 3 2021-03-15
diffoscope JSON 1.0.2 3 2018-10-17
org.tamanegi.atmosphere AtmosphereLogger diffoscope JSON 0.2.3 9 2021-03-15
diffoscope JSON 0.2.3 9 2019-01-16
org.tasks Tasks.org: Open-source To-Do Lists & Reminders diffoscope JSON 14.7.3 140710 2025-06-26
diffoscope JSON 14.7.2 140708 2025-06-04
diffoscope JSON 4.9.15 458 2021-03-15
diffoscope JSON 4.9.15 458 2018-10-17
org.thecongers.mtpms mTPMS diffoscope JSON 1.3 4 2021-03-15
diffoscope JSON 1.3 4 2018-10-17
org.tmurakam.presentationtimer Presentation Timer diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2018-10-17
org.tomdroid Tomdroid diffoscope JSON 0.7.5 14 2021-03-15
org.tuxpaint Tux Paint diffoscope JSON 0.9.35 9350 2025-06-04
diffoscope JSON 0.9.34 9340 2024-12-07
diffoscope JSON 0.9.32-2 9322 2024-02-28
diffoscope JSON 0.9.32-1 9321 2024-02-15
diffoscope JSON 0.9.23-beta_8 8 2021-03-15
diffoscope JSON 0.9.23-beta_8 8 2018-10-17
diffoscope JSON 0.9.23-beta_7 7 2021-03-15
diffoscope JSON 0.9.23-beta_7 7 2018-10-17
org.uaraven.e E numbers diffoscope JSON 1.4.1 16 2021-03-15
diffoscope JSON 1.4.1 16 2018-10-17
org.us.andriod Prism diffoscope JSON 1.4 4 2021-03-15
org.videolan.vlc VLC diffoscope JSON 3.6.5 13060508 2025-05-16
diffoscope JSON 3.6.5 13060507 2025-05-16
diffoscope JSON 3.6.5 13060506 2025-05-16
diffoscope JSON 3.6.5 13060505 2025-05-15
diffoscope JSON 3.6.4 13060408 2025-05-13
diffoscope JSON 3.6.4 13060407 2025-05-13
diffoscope JSON 3.6.4 13060406 2025-05-13
diffoscope JSON 3.6.4 13060405 2025-05-12
diffoscope JSON 3.6.3 13060308 2025-02-26
diffoscope JSON 3.6.3 13060307 2025-02-25
diffoscope JSON 3.6.3 13060306 2025-02-23
diffoscope JSON 3.6.3 13060305 2025-02-22
diffoscope JSON 3.6.0 Beta 3 13050738 2025-05-07
diffoscope JSON 3.6.0 Beta 3 13050737 2025-05-03
diffoscope JSON 3.6.0 Beta 3 13050736 2024-12-11
diffoscope JSON 3.6.0 Beta 3 13050735 2024-12-07
diffoscope JSON 3.6.0 Beta 2 13050727 2024-12-10
diffoscope JSON 3.6.0 Beta 2 13050726 2024-12-09
diffoscope JSON 3.6.0 Beta 2 13050725 2024-12-08
diffoscope JSON 3.5.4 13050408 2023-02-25
diffoscope JSON 3.5.3 13050308 2022-12-15
diffoscope JSON 3.3.4 13030408 2021-03-15
diffoscope JSON 3.3.4 13030408 2021-03-07
diffoscope JSON 3.2.12 13021208 2021-03-15
diffoscope JSON 3.2.12 13021208 2020-05-21
diffoscope JSON 3.1.7 13010707 2021-03-15
diffoscope JSON 3.1.7 13010707 2019-12-22
diffoscope JSON 2.1.20 12012007 2021-03-15
diffoscope JSON 2.1.20 12012007 2018-10-17
org.voidptr.swpieview SwpieView diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
org.wentura.getflow GetFlow diffoscope JSON 1.0.0 1 2021-03-15
diffoscope JSON 1.0.0 1 2020-12-29
org.woheller69.omweather Cirrus diffoscope JSON 4.2 42 2025-07-16
diffoscope JSON 4.1 41 2025-07-15
diffoscope JSON 4.0 40 2025-06-16
diffoscope JSON 3.9 39 2025-04-30
diffoscope JSON 3.8 38 2025-03-22
diffoscope JSON 3.6 36 2025-04-21
diffoscope JSON 2.5 25 2023-12-29
diffoscope JSON 2.4 24 2023-12-18
diffoscope JSON 2.3 23 2023-12-01
diffoscope JSON 2.2 22 2023-11-25
diffoscope JSON 2.1 21 2023-10-03
diffoscope JSON 2.0 20 2023-09-01
diffoscope JSON 1.8 18 2023-06-28
diffoscope JSON 1.7 17 2023-06-20
diffoscope JSON 1.6 16 2023-05-21
diffoscope JSON 1.4 14 2023-03-21
diffoscope JSON 1.3 13 2023-03-03
diffoscope JSON 1.2 12 2023-02-28
diffoscope JSON 1.1 11 2023-02-25
org.woheller69.weather RadarWeather diffoscope JSON 6.7 67 2025-07-16
diffoscope JSON 6.6 66 2025-05-30
diffoscope JSON 6.3 63 2023-12-06
diffoscope JSON 6.2 62 2023-09-01
diffoscope JSON 6.0 60 2023-05-21
diffoscope JSON 5.8 58 2023-02-19
diffoscope JSON 5.7 57 2022-12-18
diffoscope JSON 4.5 45 2022-01-09
diffoscope JSON 3.0 30 2021-04-04
diffoscope JSON 1.9 19 2021-03-15
diffoscope JSON 1.9 19 2021-03-12
diffoscope JSON 1.8 18 2021-03-15
diffoscope JSON 1.8 18 2021-03-05
diffoscope JSON 1.1 11 2021-03-15
diffoscope JSON 1.1 11 2020-12-29
org.xbmc.kodi Kodi diffoscope JSON 21.2 2102001 2025-03-10
diffoscope JSON 21.2 2102000 2025-03-10
diffoscope JSON 21.1 2101001 2025-05-03
diffoscope JSON 21.1 2101000 2025-05-06
diffoscope JSON 21.0 2100001 2024-05-15
diffoscope JSON 20.5 2005001 2024-03-10
diffoscope JSON 20.4 2004001 2024-02-14
org.xcsoar XCSoar diffoscope JSON 7.42 163 2024-03-13
diffoscope JSON 7.41 162 2024-02-20
diffoscope JSON 6.8.17 119 2021-03-15
diffoscope JSON 6.8.17 119 2021-03-11
diffoscope JSON 6.8.12 113 2021-03-15
diffoscope JSON 6.8.12 113 2019-07-02
diffoscope JSON 6.8.7 107 2021-03-15
diffoscope JSON 6.8.7 107 2018-10-17
org.xphnx.iconsubmit Turtl diffoscope JSON 2.1 9 2021-03-15
diffoscope JSON 2.1 9 2018-12-06
org.zamedev.gloomydungeons2.opensource Gloomy Dungeons 2 diffoscope JSON 2016.02.22.1800 1602221800 2021-03-15
diffoscope JSON 2016.02.22.1800 1602221800 2018-10-17
org.zephyrsoft.trackworktime Track Work Time diffoscope JSON 1.1.23 68 2024-01-09
diffoscope JSON 1.1.22 67 2023-12-17
diffoscope JSON 1.1.21 65 2023-09-07
diffoscope JSON 1.1.20 64 2022-11-05
diffoscope JSON 1.1.15 59 2022-08-13
diffoscope JSON 1.0.5 27 2021-03-15
diffoscope JSON 1.0.5 27 2019-12-22
diffoscope JSON 1.0.1 23 2021-03-15
diffoscope JSON 1.0.1 23 2018-10-17
org.zerodogg.migraineLog Migraine Log diffoscope JSON 0.12.0 834 2025-04-19
diffoscope JSON 0.11.2 756 2024-03-24
diffoscope JSON 0.7.0 447 2021-05-29
diffoscope JSON 0.6.0 405 2021-04-04
diffoscope JSON 0.4.0 334 2021-03-15
diffoscope JSON 0.4.0 334 2021-03-12
oss.krtirtho.spotube Spotube diffoscope JSON 3.5.0 29 2024-03-12
diffoscope JSON 3.4.1 28 2024-02-19
page.codeberg.marshreaper.fruitygame Fruity Game diffoscope JSON 2.6 17 2024-03-28
diffoscope JSON 2.5 16 2024-03-20
diffoscope JSON 2.4 15 2024-01-08
diffoscope JSON 2.3 14 2023-12-29
diffoscope JSON 2.2 13 2023-12-23
diffoscope JSON 2.0 11 2023-11-30
pl.hypeapp.endoscope Endoscope diffoscope JSON 1.4 5 2021-03-15
pl.kuben.progressapp Progress Tracker diffoscope JSON 0.5.5 8 2021-03-15
diffoscope JSON 0.5.5 8 2019-12-22
pl.narfsoftware.thermometer Thermometer Extended diffoscope JSON 2.5.2 29 2021-03-15
diffoscope JSON 2.5.2 29 2018-10-17
pl.nkg.geokrety GeoKrety Logger diffoscope JSON 0.9.0 beta 47 2021-03-15
diffoscope JSON 0.9.0 beta 47 2018-10-17
pl.suve.colorful.android Colorful diffoscope JSON 2.2 20200 2025-03-01
diffoscope JSON 2.0 2000 2024-03-01
priv.wh201906.serialtest SerialTest diffoscope JSON V0.3.5 35 2024-05-12
diffoscope JSON V0.3.4 34 2024-03-12
diffoscope JSON V0.3.3 33 2023-11-30
diffoscope JSON V0.3.1 31 2023-05-24
diffoscope JSON V0.2.4 24 2023-05-13
privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist Shopping List (Privacy Friendly) diffoscope JSON 1.1 8 2023-05-05
diffoscope JSON 1.0.9 7 2021-03-15
diffoscope JSON 1.0.9 7 2019-12-22
diffoscope JSON 1.0.8 6 2021-03-15
diffoscope JSON 1.0.8 6 2018-10-17
diffoscope JSON 1.0.5 3 2021-03-15
diffoscope JSON 1.0.5 3 2018-10-17
pro.kherel.selfprivacy SelfPrivacy diffoscope JSON 0.12.3 26 2025-02-27
pro.oblivioncoding.fluffy_board Fluffyboard diffoscope JSON 0.0.12 33112291 2022-12-17
pro.oneredpixel.l9droid L9Droid diffoscope JSON 0.6 4 2021-03-15
diffoscope JSON 0.6 4 2018-10-17
protect.gift_card_guard Gift Card Guard diffoscope JSON 0.4.1 6 2021-03-15
raele.concurseiro Concurseiro diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
raffarti.simpleadvancedmetronome SimpleAdvancedMetronome diffoscope JSON 0.2.0 2 2021-03-15
diffoscope JSON 0.2.0 2 2021-03-09
rino.org.tethercompanion Tether companion diffoscope JSON 0.2 2 2021-03-15
diffoscope JSON 0.2 2 2018-10-17
rodrigodavy.com.github.pixelartist Pixel Artist diffoscope JSON 3.1 4 2021-03-15
diffoscope JSON 3.1 4 2019-12-23
ru.exlmoto.snood21 Snooder 21 diffoscope JSON 1.2 3 2021-03-15
ru.gelin.android.sendtosd Send to SD card diffoscope JSON 0.3.11 41 2021-03-15
diffoscope JSON 0.3.11 41 2018-10-17
ru.hugeping.reinstead RE:INSTEAD diffoscope JSON 0.7 7 2022-08-16
ru.ifproject.android.afr AFReplacer diffoscope JSON 0.4.1 14 2021-03-15
diffoscope JSON 0.4.1 14 2018-12-06
ru.meefik.busybox BusyBox diffoscope JSON 1.34.1 51 2022-08-14
diffoscope JSON 1.31.1 46 2021-03-15
diffoscope JSON 1.31.1 46 2020-05-22
diffoscope JSON 1.30.1 40 2021-03-15
diffoscope JSON 1.30.1 40 2019-12-23
diffoscope JSON 1.25.1 27 2021-03-15
diffoscope JSON 1.25.1 27 2018-10-17
ru.natsuru.websdr WebSDR client diffoscope JSON 1.8.11 1 2022-08-11
ru.neverdark.silentnight Silent Night diffoscope JSON 0.3 8 2021-03-15
diffoscope JSON 0.3 8 2018-10-17
ru.nsu.bobrofon.easysshfs EasySSHFS diffoscope JSON 0.5.14 93 2025-02-25
diffoscope JSON 0.5.13 91 2024-12-07
diffoscope JSON 0.5.11 85 2024-02-26
diffoscope JSON 0.5.10 83 2023-12-02
diffoscope JSON 0.5.9 81 2023-05-01
diffoscope JSON 0.5.8 79 2022-08-13
ru.ttyh.neko259.notey Notey diffoscope JSON 1.3.1 6 2021-03-15
diffoscope JSON 1.3.1 6 2018-10-17
ru.zxalexis.ugaday Guess diffoscope JSON 0.15 15 2021-03-15
diffoscope JSON 0.15 15 2018-10-17
ryey.camcov CamCov diffoscope JSON 0.5 9 2021-03-15
ryey.flock FLock diffoscope JSON 0.4.3 8 2021-03-15
se.danielj.geometridestroyer Geometri Destroyer diffoscope JSON 1.0.1 2 2021-03-15
diffoscope JSON 1.0.1 2 2018-10-17
se.embargo.retroboy Retroboy diffoscope JSON 2.5.2 44 2021-03-15
se.johanhil.clipboard Copy to Clipboard diffoscope JSON 1.0 2 2021-03-15
diffoscope JSON 1.0 2 2018-10-17
se.leap.bitmaskclient Bitmask diffoscope JSON 1.5.3 182000 2025-04-24
diffoscope JSON 1.5.1 179000 2025-03-13
diffoscope JSON 1.2.0 170000 2024-02-14
diffoscope JSON 1.0.7 151 2021-03-15
diffoscope JSON 1.0.7 151 2021-03-12
diffoscope JSON 1.0.3 147 2021-03-15
diffoscope JSON 1.0.3 147 2020-06-11
diffoscope JSON 1.0.2 146 2021-03-15
diffoscope JSON 1.0.2 146 2020-01-25
se.leap.riseupvpn RiseupVPN diffoscope JSON 1.5.3 182000 2025-04-24
diffoscope JSON 1.5.1 179000 2025-03-13
diffoscope JSON 1.2.0 170000 2024-02-14
diffoscope JSON 1.0.3 147 2021-03-15
diffoscope JSON 1.0.3 147 2020-06-11
se.lublin.mumla Mumla diffoscope JSON 3.6.15 110 2025-02-21
diffoscope JSON 3.6.14 109 2025-03-09
diffoscope JSON 3.6.13 108 2025-05-02
diffoscope JSON 3.6.7 102 2024-02-05
diffoscope JSON 3.6.6 101 2024-01-20
diffoscope JSON 3.6.5 100 2023-12-02
diffoscope JSON 3.6.3 98 2022-08-12
diffoscope JSON 3.5.6 90 2021-03-15
diffoscope JSON 3.5.6 90 2021-03-09
se.norenh.rkfread RKFRead diffoscope JSON 1.2 3 2021-03-15
se.tube42.kidsmem.android Candy Memory diffoscope JSON 1.4 14 2021-03-15
diffoscope JSON 1.4 14 2018-10-17
sh.ftp.rocketninelabs.meditationassistant.opensource Meditation Assistant diffoscope JSON 1.6.9 169 2024-12-08
diffoscope JSON 1.6.8 168 2024-12-10
diffoscope JSON 1.4.0 140 2021-03-15
diffoscope JSON 1.4.0 140 2018-10-17
siir.es.adbWireless adbWireless diffoscope JSON 1.5.4 12 2021-03-15
diffoscope JSON 1.5.4 12 2018-10-17
site.leos.setter Setter - A multi-purpose search app for Android diffoscope JSON 0.1.17 18 2022-11-08
diffoscope JSON 0.1.16 17 2022-08-10
sk.madzik.android.logcatudp Logcat to UDP diffoscope JSON 0.5 5 2021-03-15
diffoscope JSON 0.5 5 2018-10-17
sk.vx.connectbot VX ConnectBot diffoscope JSON 1.7.1-30-git 30 2021-03-15
diffoscope JSON 1.7.1-30-git 30 2018-10-17
soko.ekibun.stitch Stitch diffoscope JSON v1.1.12 30 2024-02-24
sony.hidden.servicemenu Service Menu diffoscope JSON 1.1 2 2021-03-15
diffoscope JSON 1.1 2 2018-10-17
souch.smp SicMu Player diffoscope JSON 2.3.1 32 2023-04-04
diffoscope JSON 2.0 27 2022-08-13
diffoscope JSON 1.2 14 2021-03-15
space.bm835.pb Power Button diffoscope JSON 2 2 2021-03-15
diffoscope JSON 2 2 2019-12-22
space.celestia.mobilecelestia Celestia diffoscope JSON 1.8.7 622 2025-07-17
diffoscope JSON 1.8.0 606 2025-05-08
diffoscope JSON 1.7.13 598 2025-03-25
diffoscope JSON 1.7.12 593 2025-03-07
diffoscope JSON 1.7.11 586 2025-03-01
diffoscope JSON 1.7.10 580 2024-12-05
diffoscope JSON 1.7.8 570 2024-12-09
diffoscope JSON 1.7.7 562 2024-12-10
space.kraut.schluessel Krautschlüssel diffoscope JSON 1.2 3 2021-03-15
diffoscope JSON 1.2 3 2019-04-06
space.neothefox.laytray LayTray diffoscope JSON 1.9 10 2021-03-15
diffoscope JSON 1.9 10 2019-07-11
space.rocketnine.xenia Xenia diffoscope JSON 0.1.6 16 2023-11-27
starcom.snd WebRadio diffoscope JSON 1.4 4 2021-03-15
diffoscope JSON 1.4 4 2019-07-02
steele.gerry.dotty Dotty diffoscope JSON 2 2 2021-03-15
diffoscope JSON 2 2 2018-10-17
su.xash.husky Husky diffoscope JSON 1.6.1 204 2024-12-17
diffoscope JSON 1.2.2 182 2022-08-13
swati4star.createpdf PDF Converter diffoscope JSON 9.0.1 110 2023-05-23
diffoscope JSON 8.5.6 83 2021-03-15
diffoscope JSON 8.5.6 83 2019-01-16
diffoscope JSON 8.4.7 74 2021-03-15
diffoscope JSON 8.4.7 74 2018-12-06
diffoscope JSON 1.0 1 2021-03-15
systems.byteswap.aiproute AIProute diffoscope JSON 0.1 1 2021-03-15
diffoscope JSON 0.1 1 2018-10-17
szelok.app.twister Twister diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
team.swing.pendulums Pendulums diffoscope JSON 1.1.0 4 2021-03-15
diffoscope JSON 1.1.0 4 2019-12-21
diffoscope JSON 1.0.1 3 2021-03-15
diffoscope JSON 1.0.1 3 2019-07-11
tech.lolli.toolbox ServerBox diffoscope JSON 1.0.1189 11893 2025-06-21
diffoscope JSON 1.0.1189 11892 2025-06-21
diffoscope JSON 1.0.1189 11891 2025-06-20
tech.ula UserLAnd diffoscope JSON 2.8.3 7438725 2022-08-16
diffoscope JSON 2.7.2 2927098 2021-03-15
diffoscope JSON 2.7.2 2927098 2020-05-21
diffoscope JSON 2.6.3 835694 2021-03-15
diffoscope JSON 2.6.3 835694 2019-12-21
diffoscope JSON 2.1.3 39 2021-03-15
diffoscope JSON 2.1.3 39 2019-01-19
diffoscope JSON 2.1.2 38 2021-03-15
diffoscope JSON 2.1.2 38 2019-01-16
diffoscope JSON 1.0.3 34 2021-03-15
diffoscope JSON 1.0.3 34 2018-12-06
tk.al54.dev.badpixels Bad Pixel Detector diffoscope JSON 0.2 4 2021-03-15
tk.superl2.xwifi Wifi QR Code Creator diffoscope JSON 0.2.0 3 2021-03-15
diffoscope JSON 0.2.0 3 2019-04-06
tmendes.com.analyticalbalancedroid Food Scale Droid diffoscope JSON 1.2 3 2021-03-15
tn.creativeteam.newyoutubelistingapp Youtube Video Listing App (By The Creative Team) diffoscope JSON 1.6 6 2021-03-15
diffoscope JSON 1.6 6 2020-06-11
troop.com.freedcam FreeDcam diffoscope JSON 4.3.65 265 2022-08-14
diffoscope JSON 4.3.39 239 2021-03-15
diffoscope JSON 4.3.39 239 2021-03-12
diffoscope JSON 4.3.22 222 2021-03-15
diffoscope JSON 4.3.22 222 2021-03-09
diffoscope JSON 4.2 142 2021-03-15
diffoscope JSON 4.2 142 2019-12-23
ua.com.radiokot.lnaddr2invoice Lightning Address to Invoice diffoscope JSON 1.4.1 8 2025-07-17
ua.gardenapple.itchupdater Mitch diffoscope JSON 2.3.3 20303 2024-12-04
diffoscope JSON 2.3.2 20302 2024-12-07
diffoscope JSON 2.3.1 108 2024-12-02
diffoscope JSON 1.3.9 31 2021-05-29
diffoscope JSON 1.2.9 21 2021-03-15
diffoscope JSON 1.2.9 21 2021-03-07
uk.ac.ed.inf.mandelbrotmaps Mandelbrot Maps diffoscope JSON 1.01 2 2021-03-15
diffoscope JSON 1.01 2 2018-10-17
uk.ac.swansea.eduroamcat eduroamCAT diffoscope JSON 1.2.14 59 2021-03-15
diffoscope JSON 1.2.14 59 2019-12-21
uk.co.busydoingnothing.anagrams Grabagram diffoscope JSON 14 14 2024-04-10
uk.co.busydoingnothing.catverbs Catverbs diffoscope JSON 0.5 5 2021-03-15
diffoscope JSON 0.5 5 2018-10-17
uk.co.danieljarvis.android.flashback Flashback diffoscope JSON 1.16 16 2021-03-15
diffoscope JSON 1.16 16 2018-10-17
uk.co.yahoo.p1rpp.calendartrigger Calendar Trigger diffoscope JSON 1.2.0 4 2021-03-15
diffoscope JSON 1.0 1 2021-03-15
uk.me.amugofjava.anytime Anytime Podcast Player diffoscope JSON 1.3.12 182 2025-05-15
diffoscope JSON 1.3.11 166 2025-03-07
uk.openvk.android.legacy OpenVK Legacy diffoscope JSON 1.2.236-f 236 2024-02-14
diffoscope JSON 1.2.234-f 234 2024-01-26
diffoscope JSON 1.2.233-f 233 2024-01-06
diffoscope JSON 1.2.232-f 232 2023-12-16
diffoscope JSON 1.1.213-f 213 2023-11-24
diffoscope JSON 1.1.198-alpha.m2-f 198 2023-07-06
diffoscope JSON 1.1.194-alpha.m2-f 194 2023-06-28
diffoscope JSON 1.1.192-alpha.m2-f 192 2023-06-21
diffoscope JSON 1.1.188-alpha.m2-f 188 2023-06-16
diffoscope JSON 1.1.185-beta 185 2023-05-21
diffoscope JSON 1.1.183-beta 183 2023-05-08
diffoscope JSON 1.1.180-beta 180 2023-05-02
diffoscope JSON 1.1.179-beta 179 2023-04-29
diffoscope JSON 1.1.178-beta 178 2023-04-27
diffoscope JSON 1.1.176-beta 176 2023-02-26
diffoscope JSON 1.1.175-beta 175 2023-02-16
diffoscope JSON 1.0.163-beta 163 2023-01-13
diffoscope JSON 1.0.161-stable 161 2022-12-21
diffoscope JSON 1.0.155-beta 155 2022-12-15
uk.org.boddie.android.weatherforecast Weather Forecast diffoscope JSON 1.6.4 164 2021-05-31
unisiegen.photographers.activity Photographer's Notebook diffoscope JSON Beta v6.4 11 2021-03-15
diffoscope JSON Beta v6.4 11 2018-10-17
us.achromaticmetaphor.agram agram diffoscope JSON 1.4.1 21 2021-03-15
diffoscope JSON 1.4.1 21 2018-10-17
us.lindanrandy.cidrcalculator CIDR Calculator diffoscope JSON 1.20 125 2021-03-15
us.materialio.app Materialious diffoscope JSON 1.7.21 103 2025-05-22
us.spotco.ir_remote IR Remote diffoscope JSON 1.7.1 1710 2024-05-11
wiseguys.radar WiseRadar diffoscope JSON 2.4.0 12 2022-01-12
wseemann.media.romote RoMote diffoscope JSON 1.0.27 27 2024-12-10
diffoscope JSON 1.0.25 25 2022-11-05
diffoscope JSON 1.0.12 13 2021-03-15
diffoscope JSON 1.0.12 13 2019-07-02
diffoscope JSON 1.0.11 12 2021-03-15
diffoscope JSON 1.0.11 12 2019-01-16
diffoscope JSON 1.0.8 9 2021-03-15
diffoscope JSON 1.0.8 9 2018-10-17
diffoscope JSON 1.0.7 8 2021-03-15
diffoscope JSON 1.0.7 8 2018-10-17
x1125io.initdlight Init.d Light diffoscope JSON 1.0 1 2021-03-15
diffoscope JSON 1.0 1 2018-10-17
x653.all_in_gold All In Gold diffoscope JSON 1.2 12 2021-03-15
diffoscope JSON 1.2 12 2019-12-22
za.co.neilson.alarm Alarm Clock diffoscope JSON 1.3 4 2021-03-15
diffoscope JSON 1.3 4 2018-10-17
ignored packages (1)